BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0347 (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0075 - 20525996-20526073,20527084-20527170,20527700-205278... 29 2.6 07_01_0778 - 6009290-6010287,6010351-6010444 28 6.0 >03_05_0075 - 20525996-20526073,20527084-20527170,20527700-20527818, 20527983-20528221,20528324-20528380,20528506-20529131 Length = 401 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/66 (22%), Positives = 33/66 (50%) Frame = -2 Query: 571 LILRIVTWIVPRASGNYYYHILLRCSKTGVHKIYMYVCTMPKLIFLTELNSILRQIQTYY 392 L+L + W++ A Y RC +T +M +P+ + L+ ++++ ++T+Y Sbjct: 127 LVLSLSWWVIVAAQF-VYIAASKRCRRTWTGFSWMAFSGLPEFLKLSTASAVMLCLETWY 185 Query: 391 VQYFII 374 Q I+ Sbjct: 186 FQILIL 191 >07_01_0778 - 6009290-6010287,6010351-6010444 Length = 363 Score = 28.3 bits (60), Expect = 6.0 Identities = 23/58 (39%), Positives = 29/58 (50%) Frame = -2 Query: 568 ILRIVTWIVPRASGNYYYHILLRCSKTGVHKIYMYVCTMPKLIFLTELNSILRQIQTY 395 ILR V + SG YH+ R GVHKI +YV K FL E +S++ I Y Sbjct: 128 ILRRVCSLSQTQSG--LYHVAQR---GGVHKITLYVMNYVK--FLWEHDSVINNIIAY 178 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,020,666 Number of Sequences: 37544 Number of extensions: 287474 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -