BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0347 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) 33 0.28 SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24) 28 6.1 >SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) Length = 1826 Score = 32.7 bits (71), Expect = 0.28 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 5/33 (15%) Frame = +1 Query: 7 EVFSPLLFY-----FICYVSPEN*YSCNLPIIN 90 E+ SP++FY +C +SP N Y C +P+IN Sbjct: 1584 EICSPIMFYPHQSVSLCVISPINRYPCGVPLIN 1616 >SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24) Length = 1193 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 119 NTFAMNYATFFLPKTEIKNHLSK 187 NTFA+ Y TF LP++ K+ + K Sbjct: 246 NTFALLYVTFILPESRAKHVMEK 268 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,994,448 Number of Sequences: 59808 Number of extensions: 387705 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -