BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0345 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein pro... 25 3.0 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 5.2 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 9.0 >AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein protein. Length = 182 Score = 24.6 bits (51), Expect = 3.0 Identities = 20/78 (25%), Positives = 32/78 (41%), Gaps = 4/78 (5%) Frame = +3 Query: 249 QSAHSKHSDEKSETGQSENETITCASDKSSPQAGKTAKTQAVMPI----VRSEDHIDSHV 416 + A SD +++ G ++ E A+D S G ++ + M S+D + Sbjct: 68 EGAEDAGSDAEADAGAADGEE--GATDTESGAEGDDSEMDSAMKEGEEGAGSDDAVSGAD 125 Query: 417 DETNEESDVVVNKLEEKG 470 DET E D EE G Sbjct: 126 DETEESKDDAEEDSEEGG 143 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 666 KLFET*LGDLASNHETYFIT 607 ++FE LGD +N E YFIT Sbjct: 202 RVFELGLGDDDANIEDYFIT 221 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 160 PDKVVEIANSPLPKTPILQELLHVPDISQLSPLTVS 267 P+K+ I + P P+ H P SQ +P +V+ Sbjct: 367 PEKLNTIIDELFPSHPVTDWPTHQPTTSQENPESVT 402 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,293 Number of Sequences: 2352 Number of extensions: 11263 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -