Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0343
         (687 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    24   1.0  
AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    22   4.1  
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    21   9.5  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 8/85 (9%)
 Frame = -3

Query: 433 PCLFGVNSHKPFFLLHYLGF*GQTLFLIICSANY*YA-LKFLYAEM***CNTKSLFTHEI 257
           PC++   S    F +H L +    L +++C   + YA + F    +   C     + H +
Sbjct: 210 PCIYYFYSAFIIFTIHLLFY--CVLIILLCIYYFYYAFILFTVHLLLLVCIYYFYYMHLL 267

Query: 256 FCA*VI-------YLWCILFFVCLL 203
           FC   I       +L CI +F C L
Sbjct: 268 FCCAFIIFTMHLLFLLCIYYFYCAL 292


>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 1   NAHSPFYRHPH 33
           ++HSP Y+ PH
Sbjct: 225 DSHSPLYKRPH 235


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -2

Query: 521 MDFNDCFKKV 492
           + FNDCF KV
Sbjct: 192 LSFNDCFVKV 201


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,869
Number of Sequences: 336
Number of extensions: 3126
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18010165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)