BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0342 (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.9 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 9.2 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 6.9 Identities = 17/71 (23%), Positives = 32/71 (45%) Frame = -1 Query: 443 TLLNLA*LSVSISIPDTVISTCIVLMKRCIKLFAILKYVQCAKLNCTINKQNIARVTFVI 264 T L+ L+++IS T+++T + ++ +L LK V K + + FV+ Sbjct: 68 TCLDFLLLALNIS---TILTT-VRKQQQWAQLIQNLKVVATTKTKAWFLPFVVTNIIFVL 123 Query: 263 LSLIEGLQWSR 231 E W+R Sbjct: 124 FHTYEAFVWTR 134 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 328 TYFSIANNFIHLFIRTIH 381 TY+ +N H+FI IH Sbjct: 357 TYYGDLHNMGHVFISYIH 374 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,326 Number of Sequences: 336 Number of extensions: 3202 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -