BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0340 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0850 - 6641980-6642163,6642791-6644091 31 1.1 07_03_0454 + 18364654-18366594 29 3.5 01_06_1749 - 39636951-39638102 28 6.1 >01_01_0850 - 6641980-6642163,6642791-6644091 Length = 494 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/38 (47%), Positives = 22/38 (57%) Frame = -1 Query: 572 LKKLYLPDIVYYFHAALEFIHKLVFETSKILYNIKDNK 459 LKK + D+ Y ALEF HKL SK L++I NK Sbjct: 451 LKKT-VHDLEQYDRYALEFCHKLAARYSKQLFSIYQNK 487 >07_03_0454 + 18364654-18366594 Length = 646 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 608 IIYSFCGHGRLFLKKLYLPDIVYYFHAALE 519 +++ CG GR + K + D+ YYF L+ Sbjct: 330 VLWRRCGFGRFMISKERMDDMTYYFKTVLK 359 >01_06_1749 - 39636951-39638102 Length = 383 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 218 AAPPFKPKRITAYGRNRRG 274 AAPPF P RIT+Y + G Sbjct: 170 AAPPFDPSRITSYAAHPNG 188 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,728,837 Number of Sequences: 37544 Number of extensions: 346256 Number of successful extensions: 777 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -