BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0338 (690 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 6.3 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 8.4 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/30 (26%), Positives = 20/30 (66%) Frame = -3 Query: 526 FQLLHESMKSCCYEKSGSINSISNCKRSFY 437 FQ L+ ++ + C++ ++NS++N K ++ Sbjct: 396 FQPLNSAVCALCHKVFRTLNSLNNHKSIYH 425 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 416 ILQAYEYIEASFTIADRIYGST 481 +LQA EYIE A+ Y ST Sbjct: 6 LLQAAEYIERREREAEHGYAST 27 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,501 Number of Sequences: 438 Number of extensions: 2744 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -