BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0331 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 169 3e-44 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 24 1.6 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.1 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 3.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.6 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 4.8 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 4.8 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 4.8 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 4.8 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 4.8 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 4.8 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 4.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.8 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 4.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 4.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 4.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 4.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 4.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 4.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 4.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 4.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 4.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.8 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.8 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 4.8 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 169 bits (410), Expect = 3e-44 Identities = 83/134 (61%), Positives = 102/134 (76%), Gaps = 1/134 (0%) Frame = +1 Query: 268 YIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAPTFHLNVLKSFIDLFNANSRAVVDK 447 YIDK+ EYRFFKPWLG+GLLISTGQKWR+HRKLIAPTFHLNVLKSFIDLFNAN+R+VV+K Sbjct: 108 YIDKSTEYRFFKPWLGDGLLISTGQKWRNHRKLIAPTFHLNVLKSFIDLFNANARSVVEK 167 Query: 448 LKKE-ASNFDCHDYMSECTVEIYWKLLWV*ARVHKIQSGFEYAMAVMKMWRYTSLGDTQR 624 ++KE FDCH+YMSE TV+I + ++ + + FEYAMAVMKM L T + Sbjct: 168 MRKENGKEFDCHNYMSELTVDILLETAMGVSKPTRDHNAFEYAMAVMKMCDILHLRHT-K 226 Query: 625 FGLRPDLLI*IYRF 666 LRPD L + ++ Sbjct: 227 IWLRPDWLFNLTKY 240 Score = 74.1 bits (174), Expect = 1e-15 Identities = 34/82 (41%), Positives = 55/82 (67%) Frame = +2 Query: 8 VILWYAYWRMSRRRLYELADKLNXXXXXXXXXNALEFVGGSADIFRNIVQKSADYDHESV 187 +IL++ Y+R+SRR L ELA+K+ NAL+ G +F +++K+ ++ + V Sbjct: 23 LILYFIYFRISRRHLLELAEKIPGPPALPLIGNALDLFGSPDAMFSQVLKKAENF--KDV 80 Query: 188 VKIWIGPRLLVFLYDPRDVEVI 253 VKIW+GP+L++ L DPRDVE+I Sbjct: 81 VKIWVGPKLVICLIDPRDVEII 102 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 153 FRKALTTITNPSLRSG*DLVSSSFCT-ILATW 245 FRK L NPSLR G S+ C +L W Sbjct: 27 FRKGLRLHDNPSLREGLAGASTFRCVFVLDPW 58 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 341 KNGGLIVNLSPPH 379 +NG LI N+ PPH Sbjct: 752 RNGALIYNILPPH 764 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +2 Query: 428 QELLWTNLKRKLVIL 472 +ELLWT++K+ L+I+ Sbjct: 803 KELLWTSVKKALMIV 817 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +2 Query: 428 QELLWTNLKRKLVIL 472 +ELLWT++K+ L+I+ Sbjct: 841 KELLWTSVKKALMIV 855 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S +T V Sbjct: 123 EIHRDLPGKSTITTV 137 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTSV 137 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 126 PPTNSRAFPSNGSPGGPFSLSAS 58 PP S+ P G PG P S + S Sbjct: 39 PPNPSQGPPPGGPPGAPPSQNPS 61 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 576 GRYENVAIYFTWR--HTKIWAATGFVNLNLQIYG 671 GRY ++ ++ H IW GF+ L+ YG Sbjct: 44 GRYMFTYLHLLYQDVHVMIWIGFGFLMTFLRRYG 77 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 139 EIHRDLPGKSTTTTV 153 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 131 QIHRRIPGRSRVTEV 87 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,960 Number of Sequences: 438 Number of extensions: 3824 Number of successful extensions: 39 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -