BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0330 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55400.1 68416.m06153 methionyl-tRNA synthetase / methionine-... 29 2.9 At2g07360.1 68415.m00843 SH3 domain-containing protein contains ... 27 9.0 >At3g55400.1 68416.m06153 methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) identical to methionyl-tRNA synthetase MEtRS [Arabidopsis thaliana] GI:2266985 Length = 616 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -3 Query: 457 NSFQFSKKIVYRV*FSSLK-SHYCKSYGQD 371 NSF+FSKK+ Y FSS K + YC S Q+ Sbjct: 33 NSFRFSKKLPYYSQFSSGKRALYCTSSSQE 62 >At2g07360.1 68415.m00843 SH3 domain-containing protein contains Pfam profile PF00018: SH3 domain Length = 1196 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 279 GSSQVLTKQYELSFGVLE 332 G+S++L+K YE+ FG+LE Sbjct: 241 GNSELLSKLYEIVFGILE 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,833,754 Number of Sequences: 28952 Number of extensions: 234136 Number of successful extensions: 371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -