BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0329 (691 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 30 2.6 BT030122-1|ABN49261.1| 540|Drosophila melanogaster IP13510p pro... 29 6.0 AE014134-2225|AAF53207.2| 634|Drosophila melanogaster CG15485-P... 29 6.0 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 30.3 bits (65), Expect = 2.6 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 7/51 (13%) Frame = -1 Query: 580 GFKRPRQCSKP-------CCIHGCRCRTNCLVVFSGLQVPLGSETIDAVDS 449 G +PRQC KP CIHG +C CL G+ SE +A+ S Sbjct: 2266 GCSQPRQCHKPDDCANNLACIHG-KCTDPCLHTVCGINANCQSEGHEALCS 2315 >BT030122-1|ABN49261.1| 540|Drosophila melanogaster IP13510p protein. Length = 540 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +2 Query: 320 KVSWKFIALWENNKVYFKILNTERNQYLVLGVGTN---PNGDHMAFGVNS 460 K +W A N K ++ L ++ N+++++GV TN +GD++A V + Sbjct: 395 KTNWWSSASLRNFKERYRCLESQYNKFILMGVQTNGSLTSGDNIADNVGT 444 >AE014134-2225|AAF53207.2| 634|Drosophila melanogaster CG15485-PA protein. Length = 634 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +2 Query: 320 KVSWKFIALWENNKVYFKILNTERNQYLVLGVGTN---PNGDHMAFGVNS 460 K +W A N K ++ L ++ N+++++GV TN +GD++A V + Sbjct: 489 KTNWWSSASLRNFKERYRCLESQYNKFILMGVQTNGSLTSGDNIADNVGT 538 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,047,802 Number of Sequences: 53049 Number of extensions: 596507 Number of successful extensions: 1932 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1931 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3005453946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -