BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0329 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 25 0.68 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 3.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 8.4 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 8.4 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 8.4 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 25.0 bits (52), Expect = 0.68 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -1 Query: 538 HGCRCRTNCLVVFSGLQVPLGSETIDAVDSEGHVVAVRVSTDSQYQILVT 389 H R + L ++ L+ P+G+E+ V S G + + D + Q+L+T Sbjct: 23 HEKRLLNDLLDTYNVLERPVGNESEPLVLSFGLTLMQIIDVDEKNQLLIT 72 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 246 LTLVMMFTATMADLP 290 LTLV MFT +D+P Sbjct: 240 LTLVTMFTGLKSDIP 254 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 362 VYFKILNTERNQYLVLGVGTNPNGDHMAFGVN 457 V F+I+N N+ ++ NP+ D F ++ Sbjct: 398 VNFRIMNANVNELILNTRCENPDNDRTPFKIS 429 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 362 VYFKILNTERNQYLVLGVGTNPNGDHMAFGVN 457 V F+I+N N+ ++ NP+ D F ++ Sbjct: 398 VNFRIMNANVNELILNTRCENPDNDRTPFKIS 429 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 362 VYFKILNTERNQYLVLGVGTNPNGDHMAFGVN 457 V F+I+N N+ ++ NP+ D F ++ Sbjct: 398 VNFRIMNANVNELILNTRCENPDNDRTPFKIS 429 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,279 Number of Sequences: 438 Number of extensions: 3694 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -