BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0327 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 2.7 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 25 2.7 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.6 bits (51), Expect = 2.7 Identities = 20/59 (33%), Positives = 24/59 (40%) Frame = +1 Query: 79 GMRCVTAYGALVCGTDYCEKNPCIQPPLVCPXNTXXRXRHAGXCACCPACVTLLGEGXN 255 G +C YG C D E C + C N R H G C CPAC L+ + N Sbjct: 996 GSQC-NQYGQCPCN-DNVEGRRCDR----CKENKYDR--HQG-CLDCPACYNLVQDAAN 1045 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 425 RTQIIFRTGRDRSIASLYFPANENDYTSLVQTLLMHMRGS 306 R + + G+ A L A EN+ Q +L H+RGS Sbjct: 353 RLEKAIKVGKRAEFAKLIDIAEENELGVGYQVVLSHLRGS 392 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,595 Number of Sequences: 2352 Number of extensions: 13506 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -