BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0327 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44370.1 68416.m04767 expressed protein weak similarity to At... 29 2.0 At2g02150.1 68415.m00151 pentatricopeptide (PPR) repeat-containi... 27 8.0 At1g75470.1 68414.m08766 purine permease-related contains Pfam p... 27 8.0 >At3g44370.1 68416.m04767 expressed protein weak similarity to AtOXA1 [Arabidopsis thaliana] GI:6624207 Length = 338 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -1 Query: 631 SQNLHNY*RLMENIIIXLDELHTLSRYPDRVTCIIHTISFR 509 SQ+L NY L + +I LD H ++ P V T++FR Sbjct: 110 SQDLSNYDYLTQPVISLLDSYHDITGLPWWVVIATSTVAFR 150 >At2g02150.1 68415.m00151 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1141 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -1 Query: 304 YTQRRGFRLVPSNKSCN*XLHQ-VKLHKRDN 215 +++ + FR+ P +SCN LH+ KL K D+ Sbjct: 83 FSKMKRFRVFPKTRSCNGLLHRFAKLGKTDD 113 >At1g75470.1 68414.m08766 purine permease-related contains Pfam profile PF03151: Domain of unknown function, DUF250; low similarity to purine permease [Arabidopsis thaliana] GI:7620007 Length = 381 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 551 ISGQCM*LVEXNYYILHKSL 610 ++GQC+ + NYY LHK+L Sbjct: 49 VTGQCIARLLENYYFLHKNL 68 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,095,316 Number of Sequences: 28952 Number of extensions: 249540 Number of successful extensions: 530 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -