BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0326 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 29 0.11 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 27 0.42 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 24 4.0 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 5.2 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 29.5 bits (63), Expect = 0.11 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 444 EQHQCLAFLQQAQKHLSKLLHLDIQRTVIRQ 536 E +QC LQQAQ H+S+ +D + +RQ Sbjct: 812 EANQCQDLLQQAQYHVSRARKIDEEERSLRQ 842 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 27.5 bits (58), Expect = 0.42 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 508 STFSVPLFVRVNVPVPDVPTYILNVSRREFCPSTLTSAL 624 S S LF+ +V P+ T I+ S + CP+T A+ Sbjct: 1686 SAASAALFILASVKAPNTATDIMQRSLKNKCPNTRIQAI 1724 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 493 VNFSTSTFSVPLFVRVNVPVP 555 V+ + T VP+F +V VPVP Sbjct: 159 VSEKSKTVPVPVFQKVGVPVP 179 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.8 bits (49), Expect = 5.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 597 LPIHPHVGPYFC 632 +P+H H GPY C Sbjct: 307 VPMHNHYGPYCC 318 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 597 LPIHPHVGPYFC 632 +P+H H GPY C Sbjct: 307 VPMHNHYGPYCC 318 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 765,640 Number of Sequences: 2352 Number of extensions: 16712 Number of successful extensions: 76 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -