BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0326 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93379-3|CAB07590.1| 282|Caenorhabditis elegans Hypothetical pr... 29 2.4 Z48045-2|CAA88100.2| 967|Caenorhabditis elegans Hypothetical pr... 28 7.3 U88308-17|AAK68214.1| 657|Caenorhabditis elegans Uncoordinated ... 28 7.3 U88308-16|AAK68212.1| 586|Caenorhabditis elegans Uncoordinated ... 28 7.3 U88308-15|AAK68218.1| 548|Caenorhabditis elegans Uncoordinated ... 28 7.3 U88308-14|AAK68213.1| 546|Caenorhabditis elegans Uncoordinated ... 28 7.3 U88308-13|AAK68215.1| 534|Caenorhabditis elegans Uncoordinated ... 28 7.3 U88308-12|AAK68216.1| 467|Caenorhabditis elegans Uncoordinated ... 28 7.3 AF435952-1|AAL30828.1| 967|Caenorhabditis elegans Ser/Thr prote... 28 7.3 AF144261-1|AAD37369.1| 456|Caenorhabditis elegans AP180-like ad... 28 7.3 AF144260-1|AAD37368.1| 535|Caenorhabditis elegans AP180-like ad... 28 7.3 AF144259-1|AAD37367.1| 546|Caenorhabditis elegans AP180-like ad... 28 7.3 AF144258-1|AAD37366.1| 548|Caenorhabditis elegans AP180-like ad... 28 7.3 AF144257-1|AAD37365.1| 586|Caenorhabditis elegans AP180-like ad... 28 7.3 Z98877-16|CAH60800.1| 975|Caenorhabditis elegans Hypothetical p... 27 9.6 Z98877-15|CAB63407.3| 572|Caenorhabditis elegans Hypothetical p... 27 9.6 AC024850-2|ABA00152.1| 157|Caenorhabditis elegans Hypothetical ... 27 9.6 >Z93379-3|CAB07590.1| 282|Caenorhabditis elegans Hypothetical protein F21H7.4 protein. Length = 282 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 119 CENVERTGVCNGYFTRPHAR 178 C NV +GV NGYF++P A+ Sbjct: 117 CINVVHSGVTNGYFSQPQAQ 136 >Z48045-2|CAA88100.2| 967|Caenorhabditis elegans Hypothetical protein C41C4.4 protein. Length = 967 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 564 YVHIECFKKRVLPIHPHVGPYFCLES 641 + H E R HPHV YFC+ES Sbjct: 555 FAHREADLLRESDTHPHVIRYFCMES 580 >U88308-17|AAK68214.1| 657|Caenorhabditis elegans Uncoordinated protein 11, isoform c protein. Length = 657 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >U88308-16|AAK68212.1| 586|Caenorhabditis elegans Uncoordinated protein 11, isoform a protein. Length = 586 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >U88308-15|AAK68218.1| 548|Caenorhabditis elegans Uncoordinated protein 11, isoform h protein. Length = 548 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >U88308-14|AAK68213.1| 546|Caenorhabditis elegans Uncoordinated protein 11, isoform b protein. Length = 546 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >U88308-13|AAK68215.1| 534|Caenorhabditis elegans Uncoordinated protein 11, isoform d protein. Length = 534 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >U88308-12|AAK68216.1| 467|Caenorhabditis elegans Uncoordinated protein 11, isoform e protein. Length = 467 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >AF435952-1|AAL30828.1| 967|Caenorhabditis elegans Ser/Thr protein kinase protein. Length = 967 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 564 YVHIECFKKRVLPIHPHVGPYFCLES 641 + H E R HPHV YFC+ES Sbjct: 555 FAHREADLLRESDTHPHVIRYFCMES 580 >AF144261-1|AAD37369.1| 456|Caenorhabditis elegans AP180-like adaptor protein protein. Length = 456 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >AF144260-1|AAD37368.1| 535|Caenorhabditis elegans AP180-like adaptor protein protein. Length = 535 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >AF144259-1|AAD37367.1| 546|Caenorhabditis elegans AP180-like adaptor protein protein. Length = 546 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >AF144258-1|AAD37366.1| 548|Caenorhabditis elegans AP180-like adaptor protein protein. Length = 548 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >AF144257-1|AAD37365.1| 586|Caenorhabditis elegans AP180-like adaptor protein protein. Length = 586 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 241 YKYSLIXHRMACI-MDHFSVFIVTCNQHIDLVAGITVIGMIKDKNAFAKTKLHFRRIGDK 417 YK + H + C + FS ++ +CN +L A + +G + + + + IG+K Sbjct: 91 YKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEK 150 >Z98877-16|CAH60800.1| 975|Caenorhabditis elegans Hypothetical protein Y69H2.10b protein. Length = 975 Score = 27.5 bits (58), Expect = 9.6 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 514 FSVPLFVRVNVPVPDVPTYI-LNVSRREFCPSTLTSALTF 630 F++P F +N+ P +PT LN+S F TL + TF Sbjct: 98 FTLPTFAPLNLSFPGLPTMAPLNLSLPNFMNFTLPTMPTF 137 >Z98877-15|CAB63407.3| 572|Caenorhabditis elegans Hypothetical protein Y69H2.10a protein. Length = 572 Score = 27.5 bits (58), Expect = 9.6 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 514 FSVPLFVRVNVPVPDVPTYI-LNVSRREFCPSTLTSALTF 630 F++P F +N+ P +PT LN+S F TL + TF Sbjct: 98 FTLPTFAPLNLSFPGLPTMAPLNLSLPNFMNFTLPTMPTF 137 >AC024850-2|ABA00152.1| 157|Caenorhabditis elegans Hypothetical protein Y69A2AL.2 protein. Length = 157 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 555 RCPYVHIECFKKRVLP--IHPHVGPYFCLESYLCI 653 RC VH +C+ + +L PYFCL + C+ Sbjct: 59 RCCQVHNDCYNELLLTKKCQNSNSPYFCLYKWECV 93 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,432,032 Number of Sequences: 27780 Number of extensions: 350422 Number of successful extensions: 878 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -