BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0325 (651 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1250 + 32077590-32078000,32078132-32078308,32078437-320785... 52 4e-07 11_01_0437 - 3347960-3349246 32 0.34 05_01_0500 - 4171090-4171191,4171989-4172061,4172376-4172701,417... 29 3.2 06_03_0213 - 18063536-18063707,18063786-18064186,18064317-18064706 27 9.8 06_01_1129 + 9326975-9327071,9327174-9327306,9327408-9327479,932... 27 9.8 >04_04_1250 + 32077590-32078000,32078132-32078308,32078437-32078561, 32078629-32078761,32078866-32079015,32079105-32079158, 32079437-32079532,32080021-32080095,32080723-32080824, 32080903-32081589,32081686-32081817,32081916-32082023, 32082170-32082319 Length = 799 Score = 52.0 bits (119), Expect = 4e-07 Identities = 28/61 (45%), Positives = 37/61 (60%) Frame = +3 Query: 234 KLQRKICMMAARSLIQLYRQSMPELLHKKDRGRPTEASIELKTKKYGELETKDYIPGSEV 413 K K +AARSLI L+R+ P LL KKDRGRP A + + K +GE +PG+E+ Sbjct: 422 KSHEKAVSIAARSLITLFREICPSLLVKKDRGRP--ADPKARPKAFGEATIASDVPGAEL 479 Query: 414 L 416 L Sbjct: 480 L 480 Score = 31.9 bits (69), Expect = 0.46 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = +1 Query: 64 VPYEVIEPVMRAIANNFITERNSTDVMAVGLNAVREICTRCPLAIGEDLLRDLVQYKSYK 243 VP + +EP+ + I N F+ +R+ ++M EDLL+DLV YK Sbjct: 383 VPPDAVEPLFKQIVNQFVHDRSRPELM------------------NEDLLQDLVLYKKSH 424 Query: 244 EKSV 255 EK+V Sbjct: 425 EKAV 428 >11_01_0437 - 3347960-3349246 Length = 428 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +1 Query: 64 VPYEVIEPVMRAIANNFITERNSTDVMAVGLNAVREICTR-CPLAIGEDLL--RDLVQYK 234 +P+E+++PVMR + + + N T+V AVR + R C + + +L R L++ Sbjct: 316 LPWELLQPVMRVLGHCLLAPLNPTEVRDTAAEAVRVVYARACHELVPQAILASRSLIELD 375 Query: 235 SYKEKS 252 K+ Sbjct: 376 KSARKA 381 >05_01_0500 - 4171090-4171191,4171989-4172061,4172376-4172701, 4173164-4173555,4174521-4174853,4177118-4177209, 4178052-4178111,4178760-4178903,4180142-4180213, 4180345-4180510,4180776-4180923 Length = 635 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 240 QRKICMMAARSLIQLYRQSMPELLHK 317 +RKI + AAR L+ L+ Q P+++H+ Sbjct: 352 RRKIALGAARGLVYLHEQCDPKIIHR 377 >06_03_0213 - 18063536-18063707,18063786-18064186,18064317-18064706 Length = 320 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 176 HISRTAFNPTAITSVEFRSVIKLFAMARITGSITSYGTNSWEACAAN 36 H + PT V F+ + L+ + + + Y SW+ C N Sbjct: 227 HDGKPFLGPTNYIVVHFKDLFDLYRLRAVESLLKCYSLLSWQWCQKN 273 >06_01_1129 + 9326975-9327071,9327174-9327306,9327408-9327479, 9327593-9327736,9327950-9328021,9328219-9328278, 9328384-9328637,9329940-9330281,9332001-9332380, 9333867-9334235 Length = 640 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 240 QRKICMMAARSLIQLYRQSMPELLHK 317 +R+I + AAR L+ L+ Q P+++H+ Sbjct: 401 RRRIAVGAARGLVYLHEQCDPKIIHR 426 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,870,083 Number of Sequences: 37544 Number of extensions: 176545 Number of successful extensions: 402 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -