BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0324 (647 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0682 + 19858131-19858230,19858313-19858954,19859041-198600... 32 0.45 07_03_0766 - 21354494-21354772,21355094-21355247,21355340-213555... 30 1.8 05_07_0112 - 27755604-27756449,27756624-27756887,27757428-277575... 30 1.8 04_01_0480 + 6279576-6279755,6279863-6279988,6280074-6280151,628... 30 1.8 11_04_0144 + 14044973-14044984,14045050-14045183,14045329-140458... 29 4.2 09_02_0374 - 8112021-8112820,8112908-8113152,8113256-8113455,811... 28 5.6 07_03_1564 + 27749899-27750166,27750431-27750507,27750923-277509... 28 5.6 02_04_0213 + 20974712-20975413 28 5.6 11_01_0448 - 3469398-3469676,3470015-3470284,3470386-3470476,347... 28 7.4 05_03_0184 + 9339939-9340896,9341003-9341083,9341166-9341383,934... 28 7.4 05_01_0512 - 4259162-4259849,4260209-4260432,4260854-4261071,426... 28 7.4 03_05_1007 - 29637911-29638333,29640095-29640282,29640688-296407... 28 7.4 04_01_0485 + 6389646-6389665,6390063-6390123,6390231-6390356,639... 27 9.7 03_06_0618 - 35132077-35132830,35133690-35135212 27 9.7 01_06_1154 - 34955235-34955827,34955912-34956045,34956142-349563... 27 9.7 >10_08_0682 + 19858131-19858230,19858313-19858954,19859041-19860016, 19860105-19860147 Length = 586 Score = 31.9 bits (69), Expect = 0.45 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = -3 Query: 585 GLCMPDNVRFFPHRGKDTVRHSGIE-KDANITMSWTGRSLITRLDIPSEPGALRGRRSLI 409 G C+ N F+ + VR SG + + N + W RSL+ R D+P ALR Sbjct: 130 GSCL--NAGFYTRASNEYVRASGWDARLVNSSYRWVERSLVFRPDVPPWQAALR------ 181 Query: 408 XXLTSIGVTGGN 373 L +GVT N Sbjct: 182 DALLEVGVTPDN 193 >07_03_0766 - 21354494-21354772,21355094-21355247,21355340-21355577, 21355659-21355866,21356148-21356275,21356384-21356521, 21357234-21358080 Length = 663 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Frame = +2 Query: 425 PRKAPGSDGI----SNRVIKL-LPVQLIVMLASFSMPLWRTVSFPRCGKKRTLSG 574 P APG+ G+ +N+++++ LP+ + ++A+ S+ LW R GK +G Sbjct: 274 PDAAPGTTGVKNNSANKILEIVLPIVAVAIVAAVSILLWNIRKKRRRGKAEHFTG 328 >05_07_0112 - 27755604-27756449,27756624-27756887,27757428-27757532, 27757626-27758249,27759048-27759596,27759665-27760372, 27760449-27760658,27761266-27761421,27761524-27761664, 27762015-27762101,27762209-27762309,27763071-27763293, 27763384-27763548,27763621-27763713,27763801-27764292, 27764729-27764805,27765184-27765681,27765818-27766046 Length = 1855 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEV 400 SEV RR + PP LPP+ PM++ Sbjct: 178 SEVARRYYEPPQVMLPPLAPMQL 200 >04_01_0480 + 6279576-6279755,6279863-6279988,6280074-6280151, 6280847-6280972,6281244-6281345,6281416-6281490, 6281852-6281975,6283005-6283107,6283546-6283617, 6283662-6283788,6284125-6284180,6284438-6284453 Length = 394 Score = 29.9 bits (64), Expect = 1.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 605 DDFLVYRVYVCPITSASFHTAGKI 534 DD +YR Y+CP++ +F T ++ Sbjct: 54 DDGTIYRYYICPLSGTTFTTKSEV 77 >11_04_0144 + 14044973-14044984,14045050-14045183,14045329-14045824, 14046097-14046117,14047504-14047767,14048635-14048715 Length = 335 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIK 472 EV LIK ++P KAP DGI+ +K Sbjct: 226 EVDNLIKVIQPDKAPSPDGINGYFLK 251 >09_02_0374 - 8112021-8112820,8112908-8113152,8113256-8113455, 8113584-8114235,8114369-8114661 Length = 729 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 611 RSDDFLVYRVYVCPITSASFHTAGKI 534 RSDD+L+YR+Y C ++ G I Sbjct: 89 RSDDYLLYRMYWCSFGPENYGEGGTI 114 >07_03_1564 + 27749899-27750166,27750431-27750507,27750923-27750950, 27751117-27751261,27751351-27751429,27751515-27751633, 27751732-27752073,27754807-27754896,27755730-27755955, 27756398-27756784,27757176-27757496 Length = 693 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 590 YRVYVCPITSASFHTAGKIQFAIAALK 510 YR Y CP + AG IQ+ ++ LK Sbjct: 528 YRPYTCPYAGSECTVAGDIQYLVSHLK 554 >02_04_0213 + 20974712-20975413 Length = 233 Score = 28.3 bits (60), Expect = 5.6 Identities = 22/81 (27%), Positives = 31/81 (38%) Frame = +3 Query: 6 RAYDRYPTAENRIRMRALQRDVKSRITEVRDARWSDFLEGLAPSQRSYYRLARTLKSDTV 185 R D E ++ RD ++ E D W DF + L +L R + Sbjct: 71 RRVDEEEEEERMDQLWERDRDARAGDEERMDLLWEDFNDELL------LQLRRRQQQRAA 124 Query: 186 VTMPPLVGPSGRLAAFDDDEK 248 PP PS AA DDD++ Sbjct: 125 AGTPPSPSPSPAAAADDDDDE 145 >11_01_0448 - 3469398-3469676,3470015-3470284,3470386-3470476, 3470581-3470690,3470867-3471136,3471768-3471914 Length = 388 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 105 WSDFLEGLAPSQRSYYRL-ARTLKSDTVVTMPPLVGPS 215 W L+GLA + +YY+ AR K TVV++P GPS Sbjct: 152 WCQGLDGLASREAAYYQQGARFAKWRTVVSIPN--GPS 187 >05_03_0184 + 9339939-9340896,9341003-9341083,9341166-9341383, 9341796-9342019,9342409-9343096 Length = 722 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 287 PSTQSVDPVHVELVDSEVERRAFLPPSDALPP 382 P T ++DP + V E F+PP LPP Sbjct: 119 PLTFTIDPSAADFVGQESPVSTFVPPPPPLPP 150 >05_01_0512 - 4259162-4259849,4260209-4260432,4260854-4261071, 4261154-4261234,4261342-4262299 Length = 722 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 287 PSTQSVDPVHVELVDSEVERRAFLPPSDALPP 382 P T ++DP + V E F+PP LPP Sbjct: 119 PLTITIDPSAADFVGQESPVSTFVPPPPPLPP 150 >03_05_1007 - 29637911-29638333,29640095-29640282,29640688-29640773, 29641108-29641173,29641289-29641331,29641398-29642328 Length = 578 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -3 Query: 492 MSWTGRSLITRLDIP-SEPGA 433 MSW RSL T L+IP +PGA Sbjct: 1 MSWLARSLATSLNIPEDDPGA 21 >04_01_0485 + 6389646-6389665,6390063-6390123,6390231-6390356, 6390441-6390518,6391304-6391429,6391630-6391731, 6391802-6391948,6392237-6392360,6393608-6393737, 6393908-6394130 Length = 378 Score = 27.5 bits (58), Expect = 9.7 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 605 DDFLVYRVYVCPITSASF 552 DD +YR Y+CP++ +F Sbjct: 21 DDGTIYRYYICPVSGRTF 38 >03_06_0618 - 35132077-35132830,35133690-35135212 Length = 758 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 268 IANPVHAQHSIRGPCSCR 321 + +P H H RG CSCR Sbjct: 738 VRDPTHFHHFTRGSCSCR 755 >01_06_1154 - 34955235-34955827,34955912-34956045,34956142-34956389, 34956431-34956901 Length = 481 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 42 IRMRALQRDVKSRITEVRDARWSDFLEGLAPSQRSYYRLARTLK 173 +R++AL + +SR+ + + + DF+ L P R Y R+ +K Sbjct: 182 LRLKALNGE-RSRLAQSFEYNYGDFIPILRPFLRGYLRICEEVK 224 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,932,320 Number of Sequences: 37544 Number of extensions: 426157 Number of successful extensions: 1051 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1023 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -