BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0324 (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_16938| Best HMM Match : Exo_endo_phos (HMM E-Value=2.7e-08) 39 0.004 SB_7230| Best HMM Match : DUF137 (HMM E-Value=2.4) 39 0.004 SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) 39 0.004 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_4166| Best HMM Match : RVT_1 (HMM E-Value=0.00088) 38 0.007 SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) 38 0.009 SB_32334| Best HMM Match : UPF0058 (HMM E-Value=4.6) 38 0.009 SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 37 0.012 SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 37 0.016 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 37 0.016 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 37 0.016 SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) 37 0.016 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 37 0.016 SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 36 0.021 SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 36 0.038 SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) 36 0.038 SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.066 SB_14210| Best HMM Match : RVT_1 (HMM E-Value=0.2) 35 0.066 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.066 SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) 35 0.066 SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) 34 0.087 SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2) 34 0.087 SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.087 SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) 34 0.11 SB_55265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 33 0.15 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 33 0.15 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.20 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 33 0.20 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_17625| Best HMM Match : Myb_DNA-binding (HMM E-Value=6.8) 33 0.20 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 33 0.20 SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) 33 0.20 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_39436| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) 33 0.26 SB_31815| Best HMM Match : Lipase_GDSL (HMM E-Value=0.0024) 33 0.26 SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 32 0.35 SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) 32 0.35 SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7) 32 0.35 SB_32796| Best HMM Match : MSG (HMM E-Value=2.7) 32 0.46 SB_17785| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) 32 0.46 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 32 0.46 SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2) 32 0.46 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 32 0.46 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 32 0.46 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 32 0.46 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 32 0.46 SB_24508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 31 0.81 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 31 0.81 SB_54537| Best HMM Match : Mlp (HMM E-Value=2.4) 31 0.81 SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) 31 1.1 SB_40928| Best HMM Match : MtrG (HMM E-Value=6) 31 1.1 SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_34404| Best HMM Match : MtrG (HMM E-Value=6) 31 1.1 SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_15964| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) 31 1.1 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 31 1.1 SB_1673| Best HMM Match : MtrG (HMM E-Value=6) 31 1.1 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 31 1.1 SB_46747| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44548| Best HMM Match : MtrG (HMM E-Value=6) 31 1.1 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 31 1.1 SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 1.1 SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) 31 1.1 SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4) 31 1.1 SB_32874| Best HMM Match : Penaeidin (HMM E-Value=4.9) 30 1.4 SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) 30 1.4 SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) 30 1.4 SB_32853| Best HMM Match : RVT_1 (HMM E-Value=1.6) 30 1.4 SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51815| Best HMM Match : RVT_1 (HMM E-Value=0.23) 30 1.9 SB_43816| Best HMM Match : DUF755 (HMM E-Value=6.3) 30 1.9 SB_36393| Best HMM Match : IF2_N (HMM E-Value=5.1) 30 1.9 SB_15148| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) 30 1.9 SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_54589| Best HMM Match : Extensin_2 (HMM E-Value=0.0081) 29 2.5 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 29 2.5 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 29 2.5 SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 29 2.5 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.5 SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) 29 2.5 SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.5 SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) 29 2.5 SB_18313| Best HMM Match : Trans_reg_C (HMM E-Value=0.91) 29 2.5 SB_12038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) 29 3.3 SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) 29 3.3 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 29 3.3 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_51379| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 29 3.3 SB_43011| Best HMM Match : AgrD (HMM E-Value=3.4) 29 3.3 SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) 29 3.3 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 29 3.3 SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) 29 3.3 SB_18383| Best HMM Match : PD40 (HMM E-Value=5.5) 29 3.3 SB_7730| Best HMM Match : SUA5 (HMM E-Value=1.6) 29 3.3 SB_15891| Best HMM Match : NGP1NT (HMM E-Value=1.2) 29 4.3 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 29 4.3 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_42168| Best HMM Match : NolV (HMM E-Value=7.1) 29 4.3 SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049) 29 4.3 SB_50943| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_15616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) 28 5.7 SB_43189| Best HMM Match : PGAMP (HMM E-Value=2.1) 28 5.7 SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) 28 5.7 SB_21914| Best HMM Match : Exo_endo_phos (HMM E-Value=6e-05) 28 5.7 SB_8271| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) 28 5.7 SB_53228| Best HMM Match : CITED (HMM E-Value=2.5) 28 7.5 SB_51148| Best HMM Match : NGP1NT (HMM E-Value=1) 28 7.5 SB_46236| Best HMM Match : PABP (HMM E-Value=9.1) 28 7.5 SB_9065| Best HMM Match : YopE (HMM E-Value=7.8) 28 7.5 SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) 28 7.5 SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) 28 7.5 SB_47435| Best HMM Match : RVT_1 (HMM E-Value=7.8e-23) 28 7.5 SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) 28 7.5 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_20248| Best HMM Match : GPS (HMM E-Value=1.5) 28 7.5 SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) 27 9.9 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 27 9.9 SB_18035| Best HMM Match : Triadin (HMM E-Value=4.2) 27 9.9 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 39.1 bits (87), Expect = 0.003 Identities = 35/105 (33%), Positives = 48/105 (45%), Gaps = 9/105 (8%) Frame = +2 Query: 329 DSEVERRAFLPPSDALPP-----VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLI 493 D+ E L P D LPP VT + L+ +P KA GSD +S R++KL P + Sbjct: 471 DAPNEPLPVLAPKD-LPPLGEICVTVNGIVKLLSRQKPNKACGSDQVSARILKLAPDETA 529 Query: 494 VMLASFSMPLWRTVSFPRCGKKRTLSGIHKPGK---PKNH-PIEL 616 V+L + P K ++ IHK G P N+ PI L Sbjct: 530 VILRETFQQSLSSGVVPSDWKHAYVAPIHKKGSRSTPANYRPISL 574 >SB_16938| Best HMM Match : Exo_endo_phos (HMM E-Value=2.7e-08) Length = 554 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/84 (28%), Positives = 41/84 (48%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L DA+P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 452 NHIERLPTLSELDAMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 509 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 510 LCKCWELGSVPQDFRDCSITNLYK 533 >SB_7230| Best HMM Match : DUF137 (HMM E-Value=2.4) Length = 353 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/84 (28%), Positives = 41/84 (48%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L DA+P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 251 NHIERLPTLSELDAMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 308 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 309 LCKCWELGSVPQDFRDCSITNLYK 332 >SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) Length = 545 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/84 (28%), Positives = 41/84 (48%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L DA+P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 294 NHIERLPTLSELDAMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 351 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 352 LCKCWELGSVPQDFRDCSITNLYK 375 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/84 (28%), Positives = 41/84 (48%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L DA+P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 224 NHIERLPTLSELDAMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 281 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 282 LCKCWELGSVPQDFRDCSITNLYK 305 >SB_4166| Best HMM Match : RVT_1 (HMM E-Value=0.00088) Length = 271 Score = 37.9 bits (84), Expect = 0.007 Identities = 23/80 (28%), Positives = 38/80 (47%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 VT EV ++ + +KAPG DGI N V+K+ +L ++A R P K+ Sbjct: 6 VTDREVYVALRSTKIKKAPGPDGIPNIVLKVFAFELAPLVAHMYNISLRQGILPSSMKRA 65 Query: 563 TLSGIHKPGKPKNHPIELPP 622 ++ + K PK ++ P Sbjct: 66 VVTPLPKQMPPKRVDEDIRP 85 >SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) Length = 959 Score = 37.5 bits (83), Expect = 0.009 Identities = 28/80 (35%), Positives = 36/80 (45%), Gaps = 4/80 (5%) Frame = +2 Query: 356 LPPSDALPP--VTPME--VKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPL 523 LP D P +TP E V IK + KAPGSD I V K L+ L L Sbjct: 490 LPQVDINPDLDITPSEDEVVKAIKQMSTGKAPGSDAIPAEVFKSGGPSLLHKLTVLFQSL 549 Query: 524 WRTVSFPRCGKKRTLSGIHK 583 W + + P+ K T+ I+K Sbjct: 550 WESETLPQDFKDATIVHIYK 569 >SB_32334| Best HMM Match : UPF0058 (HMM E-Value=4.6) Length = 311 Score = 37.5 bits (83), Expect = 0.009 Identities = 28/80 (35%), Positives = 36/80 (45%), Gaps = 4/80 (5%) Frame = +2 Query: 356 LPPSDALPP--VTPME--VKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPL 523 LP D P +TP E V IK + KAPGSD I V K L+ L L Sbjct: 144 LPQVDINPDLDITPSEDEVVKAIKQMSTGKAPGSDAIPAEVFKSGGPSLLHKLTVLFQSL 203 Query: 524 WRTVSFPRCGKKRTLSGIHK 583 W + + P+ K T+ I+K Sbjct: 204 WESETLPQDFKDATIVHIYK 223 >SB_42513| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 519 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLL 478 P TP E+ ++K L+ K+PG D I N VIK + Sbjct: 181 PFTPQEIDKVVKGLKNNKSPGPDNILNEVIKAI 213 >SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 36.7 bits (81), Expect = 0.016 Identities = 26/76 (34%), Positives = 36/76 (47%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P TP E++ ++K L K G D I N VIK + L+ +L + + FP + Sbjct: 654 PFTPQEIEKVVKGL---KNIGLDNILNEVIKAISSALLPILVKLLNKILESGEFPTVLAR 710 Query: 560 RTLSGIHKPGKPKNHP 607 L IHK G KN P Sbjct: 711 GYLVPIHKRG-DKNIP 725 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/84 (27%), Positives = 40/84 (47%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L D +P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 142 NNIERLLTLSELDEMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 199 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 200 LCKCWELGSVPQDFRDCSITNLYK 223 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 36.7 bits (81), Expect = 0.016 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 3/87 (3%) Frame = +2 Query: 371 ALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSF 541 ++PP VT E ++ + +KAPG DGI N V+K+ +L ++A R Sbjct: 482 SIPPELYVTDREAYVALRSTKIKKAPGPDGIPNIVLKVFAFELAPLVAHMYNISLRQGIL 541 Query: 542 PRCGKKRTLSGIHKPGKPKNHPIELPP 622 P K+ ++ + K PK ++ P Sbjct: 542 PPSMKRAVVTPLPKQMPPKRVDEDIRP 568 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/84 (27%), Positives = 40/84 (47%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L D +P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 96 NHIERLPTLSELDEMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 153 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 154 LCKCWELGSVPQDFRDCSITNLYK 177 >SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) Length = 381 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/84 (27%), Positives = 40/84 (47%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L D +P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 57 NHIERLPTLSELDEMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 114 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 115 LCKCWELGSVPQDFRDCSITNLYK 138 >SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) Length = 717 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/84 (27%), Positives = 40/84 (47%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L D +P T +E++ IK + KAPG DGI + K +L+ L Sbjct: 286 NHIERLPTLSELDEMP--TKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 343 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 344 LCKCWELGSVPQDFRDCSITNLYK 367 >SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 470 Score = 36.3 bits (80), Expect = 0.021 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Frame = +2 Query: 383 VTPME--VKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGK 556 +TP E V IK + KAPGSD I V K L+ L LW + + P+ K Sbjct: 9 ITPSEDEVVKAIKQMSTGKAPGSDAIPAEVFKSGGPSLLHKLTVLFQSLWESETLPQDFK 68 Query: 557 KRTLSGIHK 583 T+ I+K Sbjct: 69 DATIVHIYK 77 >SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1808 Score = 35.5 bits (78), Expect = 0.038 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 3/75 (4%) Frame = +2 Query: 368 DALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVS 538 + +PP VT E ++ ++ RKAPG D I N+V+K +L ++A R S Sbjct: 1326 EEIPPECIVTTREASLSLRSIQLRKAPGPDDIPNKVLKEFAFELAPIIADIYNASVREGS 1385 Query: 539 FPRCGKKRTLSGIHK 583 P K+ + + K Sbjct: 1386 LPAILKRAAVCPLPK 1400 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 35.5 bits (78), Expect = 0.038 Identities = 23/84 (27%), Positives = 40/84 (47%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L DA+P +E++ IK + KAPG DGI + K +L+ L Sbjct: 2022 NHIERLPTLYELDAMP--IKVELREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFQL 2079 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 2080 LCKCWELGSVPQDFRDCSITNLYK 2103 >SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 736 Score = 35.5 bits (78), Expect = 0.038 Identities = 22/80 (27%), Positives = 36/80 (45%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ ++ RKA G DGI N ++K +L ++A L R P K Sbjct: 460 VSSREAGIALQSIKLRKAGGPDGIPNIILKTFSFELAPVIAEIYNALLREGYLPPLLKSA 519 Query: 563 TLSGIHKPGKPKNHPIELPP 622 ++ I K P+ +L P Sbjct: 520 AITPIPKQRPPRTIDSDLRP 539 >SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) Length = 889 Score = 35.5 bits (78), Expect = 0.038 Identities = 22/84 (26%), Positives = 40/84 (47%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASF 511 + +ER L D +P T ++++ IK + KAPG DGI + K +L+ L Sbjct: 498 NHIERLPTLSELDEMP--TKVDLREAIKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKL 555 Query: 512 SMPLWRTVSFPRCGKKRTLSGIHK 583 W S P+ + +++ ++K Sbjct: 556 LCKCWELGSVPQDFRDCSITNLYK 579 >SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 750 Score = 34.7 bits (76), Expect = 0.066 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 368 DALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 D++PP TP E + ++ ++ +KAPG DG+ N ++K Sbjct: 287 DSVPPDLLATPWEAELALRGIKVKKAPGPDGLPNIILK 324 >SB_14210| Best HMM Match : RVT_1 (HMM E-Value=0.2) Length = 712 Score = 34.7 bits (76), Expect = 0.066 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 368 DALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 D++PP TP E + ++ ++ +KAPG DG+ N ++K Sbjct: 283 DSVPPDLLATPWEAELALRGIKVKKAPGPDGLPNIILK 320 >SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 34.7 bits (76), Expect = 0.066 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 368 DALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 D++PP TP E + ++ ++ +KAPG DG+ N ++K Sbjct: 679 DSVPPDLLATPWEAELALRGIKVKKAPGPDGLPNIILK 716 Score = 31.1 bits (67), Expect = 0.81 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 362 PSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLAS 508 P L PVT +V + L+P KA G D I +++K+ +L L S Sbjct: 276 PCRELRPVTEGQVLKELHSLKPEKAAGCDAIPPKLLKIGETELAKPLTS 324 >SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) Length = 884 Score = 34.7 bits (76), Expect = 0.066 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 368 DALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 D++PP TP E + ++ ++ +KAPG DG+ N ++K Sbjct: 539 DSVPPDLLATPWEAELALRGIKVKKAPGPDGLPNIILK 576 Score = 31.1 bits (67), Expect = 0.81 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 362 PSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLAS 508 P L PVT +V + L+P KA G D I +++K+ +L L S Sbjct: 136 PCRELRPVTEGQVLKELHSLKPEKAAGCDAIPPKLLKIGETELAKPLTS 184 >SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) Length = 666 Score = 34.3 bits (75), Expect = 0.087 Identities = 30/93 (32%), Positives = 43/93 (46%), Gaps = 6/93 (6%) Frame = +2 Query: 266 TLQTQCTPSTQSVDPVHVELVDSEVERRAF-LPPSDALP----PVTPMEVKXLIKDLRPR 430 TL T+ + + V L E E A LPP D L P T +EV+ I+ ++ Sbjct: 411 TLTTEREQAARWVQHFQEVLNQPEPEEPANPLPPQDILNIDTGPPTALEVREAIRTMKNG 470 Query: 431 KAPGSDGISNRVIKL-LPVQLIVMLASFSMPLW 526 KAPG D I +++ L V+L FS +W Sbjct: 471 KAPGIDSIHAEIVQADLDTSTTVLLDLFS-KIW 502 >SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2) Length = 368 Score = 34.3 bits (75), Expect = 0.087 Identities = 21/68 (30%), Positives = 32/68 (47%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKRTLSG 574 EVK I L+ K+PG D I+ ++K P L + + +WR + P KK + Sbjct: 124 EVKDTITTLKNGKSPGIDNITAELLKADPEFLDERVHKLLVKVWRHKTIPNDWKKGLIIK 183 Query: 575 IHKPGKPK 598 + K G K Sbjct: 184 LPKKGNLK 191 >SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 34.3 bits (75), Expect = 0.087 Identities = 26/84 (30%), Positives = 36/84 (42%) Frame = +2 Query: 350 AFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWR 529 A PP DAL V+ + V + L PRKA G DGI V+ L + +R Sbjct: 223 AHFPPDDALQ-VSELSVLQKLYALNPRKASGPDGIPGWVLNESADLLATSVTDILKSSFR 281 Query: 530 TVSFPRCGKKRTLSGIHKPGKPKN 601 P+ K ++ + K KP N Sbjct: 282 EARLPQYWKDADIAPVPKQ-KPIN 304 >SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) Length = 523 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 368 DALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 D++PP TP E + ++ ++ +KAPG DG N ++K Sbjct: 38 DSVPPDLLATPWEAELALRGIKVKKAPGPDGFPNIILK 75 >SB_55265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 VTP E ++ ++ RKA G DGI N+V L +L ++A Sbjct: 149 VTPREATAALRSIKLRKALGPDGIPNKVWSLFAFELAPVVA 189 >SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 647 Score = 33.5 bits (73), Expect = 0.15 Identities = 20/70 (28%), Positives = 32/70 (45%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKRTLSG 574 EVK I L+ K+PG D I+ ++K P + + +WR + P KK + Sbjct: 333 EVKDTITTLKNGKSPGIDNITAELLKADPEFSAERVHKLLVKVWRHETIPNDWKKGLIIK 392 Query: 575 IHKPGKPKNH 604 + K G K + Sbjct: 393 LPKKGNLKEY 402 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 33.5 bits (73), Expect = 0.15 Identities = 26/95 (27%), Positives = 41/95 (43%) Frame = +2 Query: 338 VERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSM 517 VE F P D L +TP V + +++ +K+PG D + NR+ K +L ++ Sbjct: 58 VEPIPFPVPDDLL--ITPRLVYQALNNIQIKKSPGPDPVPNRIWKEFAFELSPVVCDLYN 115 Query: 518 PLWRTVSFPRCGKKRTLSGIHKPGKPKNHPIELPP 622 R P K+ + I K PK +L P Sbjct: 116 SSLREGCVPDQLKESIIRPIPKCSPPKKPQDDLRP 150 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L ++R+ FP+ Sbjct: 1275 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIIFRSGVFPQ 1325 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 33.1 bits (72), Expect = 0.20 Identities = 20/80 (25%), Positives = 35/80 (43%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ + KAPG DGI R++K+ L ++A + FP K Sbjct: 439 VSSYEAYKSLRGILTNKAPGPDGIPARILKMFAFGLSPIVAELYNTSLKEGHFPGLLKSA 498 Query: 563 TLSGIHKPGKPKNHPIELPP 622 + + K PK+ ++ P Sbjct: 499 NVRPLPKLSPPKSIETDIRP 518 >SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/80 (26%), Positives = 35/80 (43%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ ++ RKA G DGI N ++K +L ++A R P K Sbjct: 546 VSSREAGIALQSIKLRKAGGPDGIPNIILKTFSFELAPVIAEIYNASLREGYLPPLLKSA 605 Query: 563 TLSGIHKPGKPKNHPIELPP 622 ++ I K P+ +L P Sbjct: 606 AITPIPKQRPPRTIDSDLRP 625 >SB_17625| Best HMM Match : Myb_DNA-binding (HMM E-Value=6.8) Length = 217 Score = 33.1 bits (72), Expect = 0.20 Identities = 25/82 (30%), Positives = 40/82 (48%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 115 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 171 Query: 491 IVMLASFSMPLWRTVSFPRCGK 556 +S R SF +CGK Sbjct: 172 RAFFSSSLTSSGRLKSFLKCGK 193 >SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) Length = 867 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/80 (26%), Positives = 35/80 (43%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ ++ RKA G DGI N ++K +L ++A R P K Sbjct: 546 VSSREAGIALQSIKLRKAGGPDGIPNIILKTFSFELAPVIAEIYNASLREGYLPPLLKSA 605 Query: 563 TLSGIHKPGKPKNHPIELPP 622 ++ I K P+ +L P Sbjct: 606 AITPIPKQRPPRTIDSDLRP 625 >SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) Length = 376 Score = 33.1 bits (72), Expect = 0.20 Identities = 20/80 (25%), Positives = 35/80 (43%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ + KAPG DGI R++K+ L ++A + FP K Sbjct: 59 VSSYEAYKSLRGILTNKAPGPDGIPARILKMFAFGLSPIVAELYNTSLKEGHFPGLLKSA 118 Query: 563 TLSGIHKPGKPKNHPIELPP 622 + + K PK+ ++ P Sbjct: 119 NVRPLPKLSPPKSIETDIRP 138 >SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 386 TPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 T +E+ IK L+ KAPG+D I N V+K Sbjct: 835 TELEITNAIKSLKTGKAPGADNILNEVLK 863 >SB_39436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 32.7 bits (71), Expect = 0.26 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRT 532 P+T EV+ K L+ +KA D ++N +IK + L V F+ LWR+ Sbjct: 77 PITLEEVQSTAKLLKNKKASAGDSLNNEIIKADGISLAV-CRDFTEFLWRS 126 >SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) Length = 469 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 386 TPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 T +E+ IK L+ KAPG+D I N V+K Sbjct: 132 TELEITNAIKSLKTGKAPGADNILNEVLK 160 >SB_31815| Best HMM Match : Lipase_GDSL (HMM E-Value=0.0024) Length = 1163 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 386 TPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 T +E+ IK L+ KAPG+D I N V+K Sbjct: 1080 TELEITNAIKSLKTGKAPGADNILNEVLK 1108 >SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 32.7 bits (71), Expect = 0.26 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +2 Query: 350 AFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVI 469 A PP DAL V+ + V + L PRKA G DGI V+ Sbjct: 595 AHFPPDDALQ-VSELSVLQKLSALNPRKASGPDGIPGWVL 633 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 VT E ++ + +KAPG DGI N V+K+ +L ++A Sbjct: 3802 VTDREAYVALRSTKIKKAPGPDGIPNIVLKVFAFELAPLVA 3842 >SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 386 TPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 T +E+ IK L+ KAPG+D I N V+K Sbjct: 132 TELEITNAIKSLKTGKAPGADNILNEVLK 160 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 32.3 bits (70), Expect = 0.35 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 386 TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 TP E + ++D++ +KA G DG+ N V+K +L Sbjct: 448 TPREAEHALRDIKVKKATGPDGLHNIVLKEFAFEL 482 >SB_41699| Best HMM Match : RVT_1 (HMM E-Value=1.90002e-41) Length = 352 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/66 (25%), Positives = 32/66 (48%) Frame = +2 Query: 386 TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKRT 565 T +E++ +K + KAPG DGI + K +L+ L W S P+ + + Sbjct: 3 TKVELREAVKVISSGKAPGQDGIPAEIFKCGGDKLLDSLFKLLCKCWELGSVPQDFRDCS 62 Query: 566 LSGIHK 583 ++ ++K Sbjct: 63 ITNLYK 68 >SB_28083| Best HMM Match : Uso1_p115_C (HMM E-Value=5.7) Length = 307 Score = 32.3 bits (70), Expect = 0.35 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKRTLSG 574 EVK I L+ K+PG D I+ ++K P + + +WR + P KK + Sbjct: 138 EVKNKITTLKNGKSPGIDNITAELLKADPEFSAERVHKLLVKVWRHETIPNDWKKGLIIK 197 Query: 575 IHKPGKPK 598 + K G K Sbjct: 198 LPKKGNLK 205 >SB_32796| Best HMM Match : MSG (HMM E-Value=2.7) Length = 270 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L + R+ FP+ Sbjct: 188 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVFPQ 238 >SB_17785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.46 Identities = 20/70 (28%), Positives = 32/70 (45%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 PVT +E+K I + + K+PG DG+ VI L L +W + P+ K Sbjct: 7 PVTDLELKIAISNTKLGKSPGFDGVLPEVIVYGGRCLRAFLLILFNIIWASEIIPQVWKD 66 Query: 560 RTLSGIHKPG 589 ++ + K G Sbjct: 67 AIITILFKKG 76 >SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) Length = 836 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L + R+ FP+ Sbjct: 632 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVFPQ 682 >SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 313 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L + R+ FP+ Sbjct: 31 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVFPQ 81 >SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2) Length = 584 Score = 31.9 bits (69), Expect = 0.46 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 4/95 (4%) Frame = +2 Query: 350 AFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWR 529 ++LP S P V V+ + +++ KA G D I R+IK +L + + Sbjct: 306 SYLPSSKPTPIVQMHVVRKKLLNVQTIKAMGPDNIPARIIKEFSYELAQPVTEIFNRSFC 365 Query: 530 TVSFPRCGKKRTLSGIHKPGKPKN----HPIELPP 622 + P K T+ I K +PK+ PI L P Sbjct: 366 SGELPTIWKGSTIRPIPKVKQPKSENDTRPISLTP 400 >SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1317 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L + R+ FP+ Sbjct: 995 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVFPQ 1045 >SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) Length = 315 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L + R+ FP+ Sbjct: 31 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVFPQ 81 >SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L + R+ FP+ Sbjct: 258 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVFPQ 308 >SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 31.9 bits (69), Expect = 0.46 Identities = 24/100 (24%), Positives = 42/100 (42%) Frame = +2 Query: 290 STQSVDPVHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVI 469 +T ++ H E + V+ + +P V V+ + L+ KA G DGIS R++ Sbjct: 266 NTPTITDPHFEKLKGFVDSKTPSGTKFEIPKVMQEFVQGYLLQLQTCKATGLDGISARLL 325 Query: 470 KLLPVQLIVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 + + L +T FP K+ + I+K G Sbjct: 326 RAAAPAIAPSLTKIINQSIKTGRFPARLKEAKVCSIYKAG 365 >SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) Length = 458 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 EVK I++L+ KAPG D I N ++K L+ L + R+ FP+ Sbjct: 31 EVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVFPQ 81 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 31.9 bits (69), Expect = 0.46 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +3 Query: 351 PSCHPLMRYHPSPRWKLKX*SKTYVLARL---PVPTVYPTALLNFYPSNSS*CWHLFQCR 521 PS HP RY PS + S Y+ + L P P YP + L + PS S C HLF R Sbjct: 391 PSSHP--RYPPS-HLRYPPSSLRYLPSHLRYPPPPLRYPPSPLRYPPSLSPICHHLFAIR 447 >SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) Length = 759 Score = 31.9 bits (69), Expect = 0.46 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +2 Query: 365 SDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVML 502 S L PVT E++ +I L P KA G I ++KLL L V L Sbjct: 461 SFVLSPVTAFEIEDIISGLNPSKASGPYSIPVCLLKLLKSYLSVPL 506 >SB_24508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 31.5 bits (68), Expect = 0.61 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 ++ E+ I+ L+ KAPG D I N +K L L + + + +P Sbjct: 147 ISEEEIIKAIEKLKSWKAPGGDNILNEFLKCSKTILKSYLGNLFNKILNSGVYPTMWSYG 206 Query: 563 TLSGIHK---PGKPKNH 604 + IHK P KP+N+ Sbjct: 207 LIVTIHKKEDPSKPENY 223 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 31.1 bits (67), Expect = 0.81 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = +3 Query: 6 RAYDRYPTAENRIRMRALQRDVKSRITEVRDARWSDFLEGLAPSQRSYYRLARTLKSDTV 185 +A + TA+N++R R R + S EV+D + ++GL S SY TLK + Sbjct: 1123 KAKESLVTAQNQLRER--DRTINSLKKEVKDKQ--SIIDGLMGSTNSYANEMTTLKKEVE 1178 Query: 186 VT 191 VT Sbjct: 1179 VT 1180 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 31.1 bits (67), Expect = 0.81 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 EV+ + + +KAPG DGISN ++K +L Sbjct: 38 EVERALSATKIKKAPGPDGISNTILKTFSFEL 69 >SB_54537| Best HMM Match : Mlp (HMM E-Value=2.4) Length = 387 Score = 31.1 bits (67), Expect = 0.81 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 5/138 (3%) Frame = +2 Query: 191 YAPPRRPLRPTRGVR**RKSRVLADTLQTQCTPSTQSVD----PVHVEL-VDSEVERRAF 355 Y P R P R ++ +LAD+++ + D P V+L + E+++ Sbjct: 210 YGPRSRNSHPVRS----KEGTLLADSIEVKGRWVEHFSDLLNLPSDVDLKIVDELDQLPI 265 Query: 356 LPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTV 535 + D PVT E++ I + + K+PG DG+ VI L L +W + Sbjct: 266 MQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCLRAFLLILFNIIWASE 323 Query: 536 SFPRCGKKRTLSGIHKPG 589 P+ K ++ + K G Sbjct: 324 IIPQVWKDAIITILFKKG 341 >SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 31.1 bits (67), Expect = 0.81 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%) Frame = +2 Query: 329 DSEVERRAFLPPSDALPPV-TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 D + R+ +P + + V T +E++ + L KAPGSD I V K L L Sbjct: 267 DEVINRQPQVPVDETMDVVPTFVEIQKAVNLLSSGKAPGSDSIPAEVYKEGGAALTEKLY 326 Query: 506 SFSMPLWRTVSFPRCGKKRTLSGIHK 583 +W + P+ K ++ ++K Sbjct: 327 QLFQLIWNHEAVPQDFKDASIIHLYK 352 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 31.1 bits (67), Expect = 0.81 Identities = 28/96 (29%), Positives = 40/96 (41%), Gaps = 5/96 (5%) Frame = +2 Query: 350 AFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWR 529 A + P DAL V+ + V + L PRKA G DGI + V+ L + +R Sbjct: 888 AHISPDDALQ-VSELSVLQKLSALNPRKAFGLDGIPSWVLNECADLLATSMTDILNCSFR 946 Query: 530 TVSFPRCGKKRTLSGI--HKPGKPKN---HPIELPP 622 P+ K ++ + KP N PI L P Sbjct: 947 EARLPQSWKDANITPVPKQKPISDVNKHLRPISLTP 982 >SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 559 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 67 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 123 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 124 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 156 >SB_40928| Best HMM Match : MtrG (HMM E-Value=6) Length = 272 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 115 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 171 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 172 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 204 >SB_37284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 30.7 bits (66), Expect = 1.1 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 6/93 (6%) Frame = +2 Query: 266 TLQTQCTPSTQSVDPVHVELVDSEVERRAF-LPPSDALP----PVTPMEVKXLIKDLRPR 430 TL T+ + + V L E E A LPP D P T +EV+ I+ ++ Sbjct: 784 TLTTEREQAARWVQHFQEVLNQPEPEEPANPLPPQDIFNIDTGPPTALEVREAIRIMKNG 843 Query: 431 KAPGSDGISNRVIKL-LPVQLIVMLASFSMPLW 526 KAPG D I +++ L V+L FS +W Sbjct: 844 KAPGIDSIHAEMLQADLDTSTTVLLDLFS-KIW 875 >SB_34404| Best HMM Match : MtrG (HMM E-Value=6) Length = 253 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 77 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 133 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 134 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 166 >SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 381 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 437 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 438 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 470 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/72 (29%), Positives = 32/72 (44%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 +P V V+ + L+ KA G DGIS R++K + L +T FP Sbjct: 28 IPKVMQEFVQGYLLQLQTCKATGLDGISARLLKAAAPAIAPSLTKIINQSIKTGRFPARW 87 Query: 554 KKRTLSGIHKPG 589 K+ + I+K G Sbjct: 88 KEAKVCPIYKAG 99 >SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/73 (24%), Positives = 35/73 (47%) Frame = +2 Query: 371 ALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRC 550 ++P +TP + + ++ KA G DGIS +++KL + + L + FP Sbjct: 235 SIPEMTPDLIGRYLSTIKISKATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIFPTI 294 Query: 551 GKKRTLSGIHKPG 589 K+ ++ + K G Sbjct: 295 WKQAQVTPVFKAG 307 >SB_15964| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) Length = 602 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 466 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 522 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 523 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 555 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 +P V V+ + L+ KA G DGIS R+++ + + L +T FP Sbjct: 114 IPKVMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIALSLTKIINQSIKTGRFPARW 173 Query: 554 KKRTLSGIHKPG 589 K+ + I+K G Sbjct: 174 KEAKVCPIYKAG 185 >SB_1673| Best HMM Match : MtrG (HMM E-Value=6) Length = 220 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 115 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 171 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 172 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 204 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/73 (24%), Positives = 35/73 (47%) Frame = +2 Query: 371 ALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRC 550 ++P +TP + + ++ KA G DGIS +++KL + + L + FP Sbjct: 249 SIPEMTPDLIGRYLSTIKISKATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIFPTI 308 Query: 551 GKKRTLSGIHKPG 589 K+ ++ + K G Sbjct: 309 WKQAQVTPVFKAG 321 >SB_46747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 386 TPMEVKXLIKDLRPRKAPGSDGISNRVI 469 T +E+ IK L+ KAPG+D I N V+ Sbjct: 262 TELEITNAIKSLKTGKAPGADNILNEVL 289 >SB_44548| Best HMM Match : MtrG (HMM E-Value=6) Length = 272 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 115 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 171 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 172 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 204 >SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 675 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 115 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 171 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 172 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 204 >SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 1443 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%) Frame = +2 Query: 329 DSEVERRAFLPPSDALPPV-TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 D + R +P + + V T +E++ + L KAPGSD I V K L L Sbjct: 971 DEAINRLPQVPVDETMDVVPTFVEIQKAVNILSSGKAPGSDSIPAEVYKEGGAALTEKLY 1030 Query: 506 SFSMPLWRTVSFPRCGKKRTLSGIHK 583 +W + P+ K ++ ++K Sbjct: 1031 QLFQLIWHHEAVPQDFKDASIIHLYK 1056 >SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) Length = 534 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/69 (27%), Positives = 30/69 (43%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 VT V+ L+ L+ KA G DG RV+K + + +L + PR + Sbjct: 329 VTEEGVRKLLAGLKSSKAAGPDGFHPRVLKECALVISPILKQIFQKSLDACNLPREWRIA 388 Query: 563 TLSGIHKPG 589 + +HK G Sbjct: 389 NICPVHKKG 397 >SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4) Length = 378 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 115 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 171 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 172 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 204 >SB_32874| Best HMM Match : Penaeidin (HMM E-Value=4.9) Length = 192 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/95 (26%), Positives = 40/95 (42%) Frame = +2 Query: 338 VERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSM 517 VE F P D L +TP V + +++ +K+PG D + NR+ K +L ++ Sbjct: 4 VEPIPFPVPEDLL--ITPRLVYQALNNIQIKKSPGPDPVPNRIWKEFAFELSPVVCDLYN 61 Query: 518 PLWRTVSFPRCGKKRTLSGIHKPGKPKNHPIELPP 622 R P K+ + I K K +L P Sbjct: 62 SSLREGCVPDQLKESIIRPIPKCSPSKKPQDDLRP 96 >SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) Length = 1092 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%) Frame = +2 Query: 329 DSEVERRAFLPPSDALPPV-TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 D + R +P + + V T +E++ + L KAPGSD I V K L L Sbjct: 496 DEAINRLPQVPVDETMDVVPTFVEIQKAVNLLSSGKAPGSDSIPAEVYKEGGAALTEKLY 555 Query: 506 SFSMPLWRTVSFPRCGKKRTLSGIHK 583 +W + P+ K ++ ++K Sbjct: 556 QLFQLIWNHEAVPQDFKDASIIHLYK 581 >SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1395 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%) Frame = +2 Query: 329 DSEVERRAFLPPSDALPPV-TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 D + R +P + + V T +E++ + L KAPGSD I V K L L Sbjct: 536 DEAINRLPQVPVDETMDVVPTFVEIQKAVNLLSSGKAPGSDSIPAEVYKEGGAALTEKLY 595 Query: 506 SFSMPLWRTVSFPRCGKKRTLSGIHK 583 +W + P+ K ++ ++K Sbjct: 596 QLFQLIWNHEAVPQDFKDASIIHLYK 621 >SB_56661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 332 SEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 + +ER L DA+P +E++ IK + KAPG DGI + K Sbjct: 82 NHIERLPTLYELDAMP--IKVELREAIKVISSGKAPGQDGIPAEIFK 126 >SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) Length = 558 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 362 PSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLAS 508 P L PVT +V + L+P KA G D I +++K+ +L L S Sbjct: 34 PCRELRPVTEGQVLKELHSLKPGKAAGCDAIPPKLLKIGETELAKPLTS 82 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 362 PSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLAS 508 P L PVT +V + L+P KA G D I +++K+ +L L S Sbjct: 481 PCRELRPVTEGQVLKELHSLKPGKAAGCDAIPPKLLKIGETELAKPLTS 529 >SB_32853| Best HMM Match : RVT_1 (HMM E-Value=1.6) Length = 358 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%) Frame = +2 Query: 329 DSEVERRAFLPPSDALPPV-TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 D + R +P + + V T +E++ + L KAPGSD I V K L L Sbjct: 79 DEAINRLPQVPVDETMDVVPTFVEIQKAVNLLSSGKAPGSDSIPAEVYKEGGAALTEKLY 138 Query: 506 SFSMPLWRTVSFPRCGKKRTLSGIHK 583 +W + P+ K ++ ++K Sbjct: 139 QLFQLIWNHEAVPQDFKDASIIHLYK 164 >SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1766 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%) Frame = +2 Query: 329 DSEVERRAFLPPSDALPPV-TPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 D + R +P + + V T +E++ + L KAPGSD I V K L L Sbjct: 401 DEAINRLPQVPVDETMDVVPTFVEIQKAVNLLSSGKAPGSDSIPAEVYKEGGAALTEKLY 460 Query: 506 SFSMPLWRTVSFPRCGKKRTLSGIHK 583 +W + P+ K ++ ++K Sbjct: 461 QLFQLIWNHEAVPQDFKDASIIHLYK 486 >SB_51815| Best HMM Match : RVT_1 (HMM E-Value=0.23) Length = 297 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +2 Query: 338 VERRAFLPPSDALPP----VTPMEVKXLIKDLRPRKAPGSDGISNRVIK 472 +ER P+D + P ++ E+ I L+ KAPG+D + N V+K Sbjct: 12 IERICPKQPADTVGPLHFQISGTEITTAIDKLKSGKAPGADNVLNEVLK 60 >SB_43816| Best HMM Match : DUF755 (HMM E-Value=6.3) Length = 539 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 VTP E ++ ++ RKA G D I N+V L +L +A Sbjct: 396 VTPREATAALRSIKLRKALGPDRIPNKVWSLFAFELAPFVA 436 >SB_36393| Best HMM Match : IF2_N (HMM E-Value=5.1) Length = 275 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 90 VDLKIVD-ELDQLPIMLSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 146 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 147 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 179 >SB_15148| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) Length = 683 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/93 (25%), Positives = 42/93 (45%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E ++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 466 VDLKIVD-EFDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCL 522 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 523 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 555 >SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 338 VERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 VE F P D L +TP V + +++ +K+PG D + NR+ K +L Sbjct: 478 VEPIPFPVPDDLL--ITPRLVYQALNNIQIKKSPGPDPVPNRIWKEFAFEL 526 >SB_54589| Best HMM Match : Extensin_2 (HMM E-Value=0.0081) Length = 667 Score = 29.5 bits (63), Expect = 2.5 Identities = 24/89 (26%), Positives = 39/89 (43%) Frame = +2 Query: 185 SNYAPPRRPLRPTRGVR**RKSRVLADTLQTQCTPSTQSVDPVHVELVDSEVERRAFLPP 364 + ++P RP+R T T+ P++ V PV S + + AF P Sbjct: 318 AGHSPHSRPIRRTHSSSSPGVPPSPPPTMTIVSKPTSTPV-PVPRRATFSGLPQAAFSQP 376 Query: 365 SDALPPVTPMEVKXLIKDLRPRKAPGSDG 451 + + P +P + K+L RK+P SDG Sbjct: 377 TKKITPTSPQSMG---KELTSRKSPFSDG 402 >SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) Length = 1074 Score = 29.5 bits (63), Expect = 2.5 Identities = 24/93 (25%), Positives = 42/93 (45%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 V +++VD E ++ + D PVT E++ I + + K+PG DG+ VI L Sbjct: 526 VDLKIVD-EFDQLPIMQSMD--DPVTDQELEKAISNTKLVKSPGFDGVLPEVIVYGGRCL 582 Query: 491 IVMLASFSMPLWRTVSFPRCGKKRTLSGIHKPG 589 L +W + P+ K ++ + K G Sbjct: 583 RAFLLILFNIIWASEIIPQVWKDAIITILFKKG 615 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 29.5 bits (63), Expect = 2.5 Identities = 20/72 (27%), Positives = 32/72 (44%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 +P V V+ + L+ KA G DGIS R+++ + L +T FP Sbjct: 28 IPKVMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPTRW 87 Query: 554 KKRTLSGIHKPG 589 K+ + I+K G Sbjct: 88 KEAKVCPIYKAG 99 >SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 855 Score = 29.5 bits (63), Expect = 2.5 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 2/88 (2%) Frame = +2 Query: 326 VDSEVERRAFLPPSDALPPVTP--MEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVM 499 ++ E R P D V P +E++ + L KAPGSD I V K L Sbjct: 237 INDEAINRLPQVPVDETMDVAPTFVEIQKAVNLLSSGKAPGSDSIPAEVYKEGGAALTEK 296 Query: 500 LASFSMPLWRTVSFPRCGKKRTLSGIHK 583 L +W + P+ K ++ ++K Sbjct: 297 LYQLFQLIWNHEAVPQDFKDASIIHLYK 324 >SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 591 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/70 (27%), Positives = 31/70 (44%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 PVT E++ I + + K+PG DG+ VI L L +W + P+ K Sbjct: 10 PVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCLRAFLLILFNIIWASEIIPQVWKD 69 Query: 560 RTLSGIHKPG 589 ++ + K G Sbjct: 70 AIITILFKKG 79 >SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) Length = 432 Score = 29.5 bits (63), Expect = 2.5 Identities = 20/72 (27%), Positives = 32/72 (44%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 +P V V+ + L+ KA G DGIS R+++ + L +T FP Sbjct: 340 IPKVMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPARW 399 Query: 554 KKRTLSGIHKPG 589 K+ + I+K G Sbjct: 400 KEAKVCPIYKAG 411 >SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 388 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/70 (27%), Positives = 31/70 (44%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 PVT E++ I + + K+PG DG+ VI L L +W + P+ K Sbjct: 7 PVTDQELEKAISNTKLGKSPGFDGVLPEVIVYGGRCLRAFLLILFNIIWASEIIPQVWKD 66 Query: 560 RTLSGIHKPG 589 ++ + K G Sbjct: 67 AIITILFKKG 76 >SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) Length = 511 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 VTP E ++ + RKA G DGI N+V L + +A Sbjct: 149 VTPREATSALRFFKLRKALGPDGIPNKVWSLFAFEFAPFVA 189 >SB_18313| Best HMM Match : Trans_reg_C (HMM E-Value=0.91) Length = 567 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/80 (22%), Positives = 34/80 (42%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ + KAPG DGI ++K+ +L ++A + P K Sbjct: 310 VSSYETYKSLRGILTNKAPGPDGIPALILKMFAFELSPIVAELYNTSLKEGHLPGLLKSA 369 Query: 563 TLSGIHKPGKPKNHPIELPP 622 + + K PK+ ++ P Sbjct: 370 NVHPLPKLSPPKSIETDIRP 389 >SB_12038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 29.5 bits (63), Expect = 2.5 Identities = 20/72 (27%), Positives = 32/72 (44%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 +P V V+ + L+ KA G DGIS R+++ + L +T FP Sbjct: 28 IPKVMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPARW 87 Query: 554 KKRTLSGIHKPG 589 K+ + I+K G Sbjct: 88 KEAKVCPIYKAG 99 >SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) Length = 392 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 + PVT +V + L RKA GSD I ++++K+ +L LA+ ++P Sbjct: 78 IKPVTQGQVSGALGALNIRKATGSDQIPSKLLKIGAEELARPLATLYNSCITAGAWPSAW 137 Query: 554 KKRTLSGIHK 583 K+ ++K Sbjct: 138 KRGDWIPVYK 147 >SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) Length = 504 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P T E I + P KAPG+D I + K + L +W+ + P+ K Sbjct: 281 PPTFEETVKAISLMSPGKAPGADAIPAEIYKACGPIAVNKLTELLQSMWQKETIPQDLKD 340 Query: 560 RTLSGIHK 583 ++ ++K Sbjct: 341 ASIVHLYK 348 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/80 (22%), Positives = 34/80 (42%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ + KAPG DGI ++K+ +L ++A + P K Sbjct: 59 VSSHEAYKSLRGILTNKAPGPDGIPALILKMFAFELSPIVAELYNTSLKEGHLPGLLKSA 118 Query: 563 TLSGIHKPGKPKNHPIELPP 622 + + K PK+ ++ P Sbjct: 119 NVRPLPKLSPPKSIETDIRP 138 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 +P + V+ + L+ KA G DGIS R+++ + L +T FP Sbjct: 442 IPKIMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPTIAPSLTKIINQSIKTGRFPARW 501 Query: 554 KKRTLSGIHKPG 589 K+ + I+K G Sbjct: 502 KEAKVCPIYKAG 513 >SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P T E I + P KAPG+D I + K + L +W+ + P+ K Sbjct: 28 PPTFEETVKAISLMSPGKAPGADAIPAEIYKACGPIAVNKLTELLQSMWQKETIPQDLKD 87 Query: 560 RTLSGIHK 583 ++ ++K Sbjct: 88 ASIVHLYK 95 >SB_51379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 368 DALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLL 478 + + P + E+ IK + KAPG DGI V K L Sbjct: 116 ELIDPPSMEELTKAIKQMSSGKAPGKDGIPTEVYKAL 152 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 EV+ + + +KAPG DGI N ++K +L Sbjct: 171 EVERALSATKIKKAPGPDGIPNTILKTFSFEL 202 >SB_43011| Best HMM Match : AgrD (HMM E-Value=3.4) Length = 241 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = +2 Query: 371 ALPP---VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 ++PP V+ E + + KAPG DGI N V+K+ +L ++A Sbjct: 119 SIPPELFVSDREAYVALWSTKIEKAPGPDGIPNIVLKVFAFELASLVA 166 >SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) Length = 887 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 + PVT +V + L RKA GSD I ++++K+ +L LA+ ++P Sbjct: 679 IKPVTQGQVSGALGALNIRKATGSDQIPSKLLKIGAEELARPLATLYNSCITAGAWPSAW 738 Query: 554 KKRTLSGIHK 583 K+ ++K Sbjct: 739 KRGDWIPVYK 748 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 +P + V+ + L+ KA G DGIS R+++ + L +T FP Sbjct: 28 IPKIMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPTIAPSLTKIINQSIKTGRFPARW 87 Query: 554 KKRTLSGIHKPG 589 K+ + I+K G Sbjct: 88 KEAKVCPIYKAG 99 >SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) Length = 831 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 EV+ + + +KAPG DGI N ++K +L Sbjct: 54 EVERALSATKIKKAPGPDGIPNTILKTFSFEL 85 >SB_18383| Best HMM Match : PD40 (HMM E-Value=5.5) Length = 352 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 498 CWHLFQCRYGELYLSRGVE 554 CW+LF RYG YLS +E Sbjct: 279 CWYLFDPRYGHKYLSSCLE 297 >SB_7730| Best HMM Match : SUA5 (HMM E-Value=1.6) Length = 325 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWR-TVSFPRCGK 556 P+T EV+ K L+ +KA D ++N +IK + + + +P ++ +V+ P Sbjct: 77 PITLEEVQSTEKLLKNKKASAGDSLNNEIIKGQTYERTFEVKEYVLPKFKVSVTLPPYAT 136 Query: 557 KRTL 568 K+ L Sbjct: 137 KKGL 140 >SB_15891| Best HMM Match : NGP1NT (HMM E-Value=1.2) Length = 422 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P + E+ IK + KA G DGI V K L + + S + +W P + Sbjct: 304 PPSMEELTKAIKQMSSGKAAGKDGIPAEVYKALSDEALYAFHSVLISIWDEEVMPADLRD 363 Query: 560 RTLSGIHK 583 ++ ++K Sbjct: 364 ASIVALYK 371 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 + P+T +V + L RKA GSD I ++++K+ +L LA+ ++P Sbjct: 256 IKPITQGQVSGALGALNIRKATGSDQIPSKLLKIGAEELARPLATLYNSCITAGAWPSAW 315 Query: 554 KKRTLSGIHK 583 K+ ++K Sbjct: 316 KRGDWIPVYK 325 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P + E+ IK + KA G DGI V K L + + S + +W P + Sbjct: 2836 PPSMEELTKAIKQMSSGKAAGKDGIPAEVYKALSDEALYAFHSVLISIWDEEVMPADLRD 2895 Query: 560 RTLSGIHK 583 ++ ++K Sbjct: 2896 ASIVALYK 2903 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 398 VKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVML 502 V+ L+ L K+PG DGIS R +K L ++ ML Sbjct: 778 VEKLLAQLDSSKSPGPDGISPRCLKELSKEVSGML 812 >SB_42168| Best HMM Match : NolV (HMM E-Value=7.1) Length = 414 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCG 553 + P+T +V + L RKA GSD I ++++K+ +L LA+ ++P Sbjct: 193 IKPITQGQVSGALGALNIRKATGSDQIPSKLLKIGAEELARPLATLYNSCITAGAWPSAW 252 Query: 554 KKRTLSGIHK 583 K+ ++K Sbjct: 253 KRGDWIPVYK 262 >SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049) Length = 588 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 EV+ + + +KAPG DGI N ++K +L Sbjct: 228 EVERALSATKIKKAPGPDGIPNTILKTFAFKL 259 >SB_50943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 377 PPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 P TP + +++++ +KA G DG+ N V K +L Sbjct: 470 PFTTPRVAEHALREIKVKKATGPDGLPNIVFKEFAFEL 507 >SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1720 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 591 LPGL-CMPDNVRFFPHRGKDTVRHSGIEKDANITMSWTGRSLITRL 457 LPGL C P + + F H G +R + + IT + T ++IT L Sbjct: 1623 LPGLGCYPWSKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITGL 1668 >SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/80 (22%), Positives = 33/80 (41%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ + KAPG DGI + K+ +L ++A + P K Sbjct: 434 VSSYEAYKSLRGILANKAPGPDGIPALIFKMFTFELSPIVAELYNTSLKEGHLPGLLKSA 493 Query: 563 TLSGIHKPGKPKNHPIELPP 622 + + K PK+ ++ P Sbjct: 494 NVRPMPKLSPPKSIETDIRP 513 >SB_15616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/73 (23%), Positives = 31/73 (42%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ + KAPG DGI ++K+ +L ++A + P K Sbjct: 84 VSSYEAYKSLRGILTNKAPGQDGIPALILKMFAFELSPIVAELYNTSLKEGHLPGLLKSA 143 Query: 563 TLSGIHKPGKPKN 601 + + K PK+ Sbjct: 144 NVRPLPKLSPPKS 156 >SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) Length = 1532 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -3 Query: 591 LPGL-CMPDNVRFFPHRGKDTVRHSGIEKDANITMSWTGRSLITRL 457 LPGL C P + + F H G +R + + IT + T ++IT L Sbjct: 1382 LPGLGCYPWSKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITGL 1427 >SB_43189| Best HMM Match : PGAMP (HMM E-Value=2.1) Length = 461 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 534 TVRHSGIEKDANITMSWTGRSLITRLDIPSEPGALRG 424 TVRH G + N+ M + +TR +P P + G Sbjct: 270 TVRHPGSYRSTNLPMLYARYDTLTRTGVPIHPCSTHG 306 >SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) Length = 359 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLA 505 V+ E ++ ++ RKA G DGI N ++K +L ++A Sbjct: 311 VSSREAGIALQSIKLRKAGGPDGIPNIILKTFSFELAPVIA 351 >SB_21914| Best HMM Match : Exo_endo_phos (HMM E-Value=6e-05) Length = 502 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/73 (23%), Positives = 31/73 (42%) Frame = +2 Query: 383 VTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKKR 562 V+ E ++ + KAPG DGI ++K+ +L ++A + P K Sbjct: 327 VSSYEAYKSLRGILTNKAPGQDGIPALILKMFAFELSPIVAELYNTSLKEGHLPGLLKSA 386 Query: 563 TLSGIHKPGKPKN 601 + + K PK+ Sbjct: 387 NVRPLPKLSPPKS 399 >SB_8271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +2 Query: 311 VHVELVDSEVERRAFLPPSDALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVI 469 V +++VD E+++ + D PVT E++ I + + K+PG DG+ VI Sbjct: 115 VDLKIVD-ELDQLPIMQSMD--DPVTDQELEKAISNTKLGKSPGFDGVLPEVI 164 >SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) Length = 1195 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P + E+ IK + KA G DGI V K L + + S + +W P + Sbjct: 590 PPSMEELTKAIKQMSSGKAAGKDGIPTEVYKALSDEALHAFHSVLISIWDGEVMPADLRD 649 Query: 560 RTLSGIHK 583 ++ ++K Sbjct: 650 ASIVALYK 657 >SB_53228| Best HMM Match : CITED (HMM E-Value=2.5) Length = 417 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 591 LPGL-CMPDNVRFFPHRGKDTVRHSGIEKDANITMSWTGRSLITRL 457 LPGL C P + F H G +R + + IT + T ++IT L Sbjct: 320 LPGLGCYPWRKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITGL 365 >SB_51148| Best HMM Match : NGP1NT (HMM E-Value=1) Length = 384 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P + E+ IK + KA G DGI V K L + + S + +W P + Sbjct: 304 PPSMEELTKAIKQMSSGKAAGKDGIPAEVYKALSDEALHAFHSVLISIWDEEVMPADLRD 363 Query: 560 RTLSGIHK 583 ++ ++K Sbjct: 364 ASIVALYK 371 >SB_46236| Best HMM Match : PABP (HMM E-Value=9.1) Length = 225 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +2 Query: 380 PVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPRCGKK 559 P + E+ IK + KA G DGI V K L + + S + +W P + Sbjct: 70 PPSMEELTKTIKQMSSGKAAGKDGIPAEVYKALSDEALHAFHSVLISIWDKEVMPADLRD 129 Query: 560 RTLSGIHK 583 ++ ++K Sbjct: 130 ASIVALYK 137 >SB_9065| Best HMM Match : YopE (HMM E-Value=7.8) Length = 153 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKL 475 + PVT +V + L RKA GSD I ++++K+ Sbjct: 119 IKPVTQGQVSGALGALNIRKATGSDQIPSKLLKI 152 >SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) Length = 485 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 428 RKAPGSDGISNRVIKLLPVQLIVML 502 +KAPG DGI N ++K +L +++ Sbjct: 179 KKAPGPDGIPNTILKTFSFELALVI 203 >SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) Length = 1606 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 591 LPGL-CMPDNVRFFPHRGKDTVRHSGIEKDANITMSWTGRSLITRL 457 LPGL C P + F H G +R + + IT + T ++IT L Sbjct: 873 LPGLGCYPWGKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITGL 918 >SB_47435| Best HMM Match : RVT_1 (HMM E-Value=7.8e-23) Length = 364 Score = 27.9 bits (59), Expect = 7.5 Identities = 20/72 (27%), Positives = 32/72 (44%) Frame = +2 Query: 368 DALPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASFSMPLWRTVSFPR 547 D +P T +E++ + L KAPGSD I V K L L +W + P+ Sbjct: 2 DVVP--TFVEIQKAVNLLSSGKAPGSDSIPAEVYKEGGAALTEKLYQLFQLIWNHEAVPQ 59 Query: 548 CGKKRTLSGIHK 583 K ++ ++K Sbjct: 60 DFKDASIIHLYK 71 >SB_43553| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.29) Length = 1851 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 591 LPGL-CMPDNVRFFPHRGKDTVRHSGIEKDANITMSWTGRSLITRL 457 LPGL C P + F H G +R + + IT + T ++IT L Sbjct: 1623 LPGLGCYPWRKQTFRHEGPTHIRTMSTTQQSKITKTITDAAVITGL 1668 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 27.9 bits (59), Expect = 7.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 563 TLSGIHKPGKPKNHPIELPPD 625 T+ H+PG P+N P + PD Sbjct: 465 TVGNPHRPGSPRNSPFVITPD 485 >SB_20248| Best HMM Match : GPS (HMM E-Value=1.5) Length = 555 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 395 EVKXLIKDLRPRKAPGSDGISNRVIKLLPVQL 490 +V+ + + +KAPG DGI N ++K +L Sbjct: 420 DVEYALSATKIKKAPGPDGIPNTILKTFSFEL 451 >SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 225 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 420 YVL--ARLPVPTVYPTALLNFYPSNS 491 YVL A LP PT Y L NFYPS++ Sbjct: 187 YVLPSAYLPTPTRYYGLLPNFYPSSN 212 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 420 YVL--ARLPVPTVYPTALLNFYPSNS 491 YVL A LP PT Y L NFYPS++ Sbjct: 1026 YVLPSAYLPTPTRYYGLLPNFYPSSN 1051 >SB_18035| Best HMM Match : Triadin (HMM E-Value=4.2) Length = 331 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 374 LPPVTPMEVKXLIKDLRPRKAPGSDGISNRVIKL 475 + P+T +V + L RKA GSD I ++++K+ Sbjct: 297 IKPITQGQVSGALGALNIRKATGSDQIPSKLLKI 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,328,274 Number of Sequences: 59808 Number of extensions: 460283 Number of successful extensions: 1476 Number of sequences better than 10.0: 146 Number of HSP's better than 10.0 without gapping: 1322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1451 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -