BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0321 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59375| Best HMM Match : TPR_2 (HMM E-Value=7.3e-06) 30 2.0 SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) 28 8.1 >SB_59375| Best HMM Match : TPR_2 (HMM E-Value=7.3e-06) Length = 383 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 156 SSREQSEGKDVEVTEAIDKTID-NPSDLLIESE 251 S+ + EG D E TEA+D I+ P LL++ E Sbjct: 348 STASEGEGSDGEYTEALDAAINQKPGSLLVQKE 380 >SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) Length = 1851 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/43 (39%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = +1 Query: 7 ERKPHQIYKIWLEMKQKKNLQ*KRLTMSQ-KRYQKKVLQKKRD 132 ER+ ++Y + ++ + LQ KRL + Q K+Y KK+LQ+K+D Sbjct: 708 EREKTRLYNDKILVEDE--LQTKRLEVQQCKKYIKKLLQEKKD 748 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,004,917 Number of Sequences: 59808 Number of extensions: 192000 Number of successful extensions: 331 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 331 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -