BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0320 (657 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 3.9 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 6.7 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 6.7 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 3.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 524 STYFITKIGTRQRDSNTSASLDYECTGTYYPF 619 STY I GT QR S L+ YY F Sbjct: 152 STYGIQVFGTMQRTSFFKTFLNSCLMDVYYEF 183 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 6.7 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 264 TSTT*MRHTP*DIVLRSQCSHNGCPTLQTETHYCFTAEIGG 386 TS H DIV Q HN L E + CF +I G Sbjct: 196 TSLIHSTHLNGDIVKEHQNLHNKICNLIDEFNECFGLQILG 236 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.4 bits (43), Expect = 6.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 450 DLRNYL*VVGPLVSPHG*VPPP 385 DL N P V PH VPPP Sbjct: 2 DLTNSTEKFLPTVLPHQEVPPP 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,805 Number of Sequences: 336 Number of extensions: 3682 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -