BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0320 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 23 2.6 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 2.6 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 4.5 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 557 QRDSNTSASLDYECTGTYYPFRATTTST 640 ++ S+T + L+ E GT+YP + T Sbjct: 133 EKVSSTLSGLEGELKGTFYPLTGMSKET 160 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 557 QRDSNTSASLDYECTGTYYPFRATTTST 640 ++ S+T + L+ E GT+YP + T Sbjct: 149 EKVSSTLSGLEGELKGTFYPLTGMSKET 176 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 404 TGRYHRPAYFCREAVMRFGLKGGAAVVTTLRP 309 +G Y PA+ + R+ L A V TT+ P Sbjct: 438 SGEYEIPAHGLPPSATRYDLGAVATVGTTVAP 469 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,205 Number of Sequences: 438 Number of extensions: 5044 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -