BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0319 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 25 0.77 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 25 0.77 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 25 0.77 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.2 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.2 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 24.6 bits (51), Expect = 0.77 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 549 ELSSVRDLRAWKPKC 593 EL+ +RD + WK KC Sbjct: 461 ELNGLRDFQEWKEKC 475 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 24.6 bits (51), Expect = 0.77 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 549 ELSSVRDLRAWKPKC 593 EL+ +RD + WK KC Sbjct: 468 ELNGLRDFQEWKEKC 482 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 24.6 bits (51), Expect = 0.77 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -1 Query: 127 KCSPIHMRSENSSKLVFFKPSHHITPQCSLKDTNNH 20 +C P+ + S++ + L SHH+ + S ++NH Sbjct: 333 RCHPLSLSSDHQAMLHHNPMSHHLKQEPSGFTSSNH 368 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 425 AGVNPLCQHTYQQLEDGAYGATVLK 351 AG + HT Q DG YG+ V++ Sbjct: 238 AGTHFWHAHTGLQKMDGLYGSVVIR 262 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 425 AGVNPLCQHTYQQLEDGAYGATVLK 351 AG + HT Q DG YG+ V++ Sbjct: 238 AGTHFWHAHTGLQKMDGLYGSVVIR 262 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,330 Number of Sequences: 336 Number of extensions: 4002 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -