BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0319 (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0484 + 14599786-14602197 29 3.5 >05_03_0484 + 14599786-14602197 Length = 803 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = -2 Query: 414 STLSAYLPATRRWCIWCYSFKIDPKSADVAKFFLLFQKENFAYKTILLHHKA--ARRLSV 241 +++ + +T I C+S I + VAK + K+ Y+T H + R + Sbjct: 401 ASIRGAMGSTATMLIACFSVCIICRLKKVAKHSFMTDKKCMTYRTEFYHSPSNLCRNFTF 460 Query: 240 GEIHVGQQTFSSSLI 196 EI V + F SL+ Sbjct: 461 DEIQVATRNFDESLL 475 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,968,457 Number of Sequences: 37544 Number of extensions: 428302 Number of successful extensions: 945 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -