BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0317 (604 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0222 - 1699009-1699698,1700922-1701247,1701342-1701513 30 1.6 09_04_0388 + 17234485-17234583,17234710-17234893,17235252-172360... 28 5.0 08_01_0154 + 1212989-1213054,1213197-1213394,1213424-1213477,121... 27 8.7 >06_01_0222 - 1699009-1699698,1700922-1701247,1701342-1701513 Length = 395 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/70 (25%), Positives = 30/70 (42%) Frame = -2 Query: 375 VDGWSTESRCVVHLGLLVKNIDYYIFGGKQTTTDRELRSNTTVTGGPPEATHRKFVLCAS 196 ++ W + RC + G D+Y F K R+N G +AT R + +S Sbjct: 51 LEPWDIQERCRIGSG---PQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYSS 107 Query: 195 SESLWFKRTL 166 S + ++TL Sbjct: 108 SNRIGMRKTL 117 >09_04_0388 + 17234485-17234583,17234710-17234893,17235252-17236057, 17236148-17236432 Length = 457 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = +2 Query: 80 LTYKDYGTKKTVDQTKR*SHVIFALSCTFSVLLNQRLSDDAHNTNLRCVASGG 238 L YGTK + H + C +++N R +DD + C+ GG Sbjct: 104 LNASKYGTKAELKSLIAAFHAK-GIKCVADIVVNHRCADDKDGRGVYCIFKGG 155 >08_01_0154 + 1212989-1213054,1213197-1213394,1213424-1213477, 1215014-1215241 Length = 181 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 55 NTPKNNRNTDLQRLRNKKDRRPNK 126 NT KN RNT L L NK++R NK Sbjct: 56 NTGKN-RNTSLSVLPNKREREKNK 78 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,271,446 Number of Sequences: 37544 Number of extensions: 273467 Number of successful extensions: 555 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -