BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0316 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0083 + 19566476-19566539,19566781-19567006,19567206-195673... 29 4.7 >02_04_0083 + 19566476-19566539,19566781-19567006,19567206-19567389, 19569483-19569582,19570015-19570122,19570373-19570452, 19570566-19570644,19570774-19570832,19570938-19571006, 19571577-19571690,19571772-19571840,19572340-19572361, 19572455-19572522,19573630-19573715,19574220-19574349, 19575032-19575133,19575211-19575279 Length = 542 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +3 Query: 21 PTSSTRLQRKQNRIIPSSRNHLNCAK*TSXRXRQCEIVPKRYALCL 158 P +S+ ++R++NR+IP R HL K R R ++P R+ L L Sbjct: 87 PVTSSDVRRERNRLIP-DRFHLILRKYHLIRARN-RLIPNRFHLIL 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,742,484 Number of Sequences: 37544 Number of extensions: 285516 Number of successful extensions: 574 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 574 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -