BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0315 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces po... 27 1.9 SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy... 25 7.7 SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces p... 25 7.7 >SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 562 Score = 27.5 bits (58), Expect = 1.9 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 62 KFYGLIASLLFSPILFVTYQMFYRFRGQVRPRFVIHQYLNFV 187 KF A+ +F LFV Y + ++ +R +F H Y V Sbjct: 385 KFTNSSATSIFVSFLFVYYMRYCTYKSLMRTQFAPHYYYALV 426 >SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 25.4 bits (53), Expect = 7.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 641 PFIYRKSNKFVYKIYSTF 588 P +Y NKFV+ Y TF Sbjct: 31 PAVYSNDNKFVFLTYDTF 48 >SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +3 Query: 480 TTTSNIF-FIRINLYRNVCPL 539 T S+ F + R+NLYR+ CPL Sbjct: 50 TERSDYFSYYRVNLYRSSCPL 70 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,463,277 Number of Sequences: 5004 Number of extensions: 48585 Number of successful extensions: 97 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -