BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0310 (635 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27757| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_56370| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50597| Best HMM Match : 7tm_1 (HMM E-Value=2.59941e-42) 29 3.2 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 4.2 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 5.5 SB_9321| Best HMM Match : DDE (HMM E-Value=5.40004e-41) 28 5.5 SB_38407| Best HMM Match : DDE (HMM E-Value=5.40004e-41) 28 5.5 >SB_27757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 62.5 bits (145), Expect = 3e-10 Identities = 27/62 (43%), Positives = 43/62 (69%) Frame = +2 Query: 254 LRKAWTDAKLNEKWTESQWAQKLANKEKRAQMTDYDRFKLTAARVKRNRARTAVFKSLKV 433 ++KA+ A++ +KW ++ WA+KLA ++KRA + D+DRFKL A+ K+NR K LK Sbjct: 281 VKKAFEAAQVQDKWEQTAWARKLAMRKKRATLNDFDRFKLKLAKQKKNRLLRTEVKKLKK 340 Query: 434 KA 439 +A Sbjct: 341 EA 342 >SB_56370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 298 CPFFIEFSICPRFPQRRVGAVNAYLRRNFVRWSWFKRI 185 C FF+ +CPR P+R G ++ R+F ++K I Sbjct: 507 CSFFLARYLCPRSPRRGWGELSLTTMRHFRCQRYYKNI 544 >SB_50597| Best HMM Match : 7tm_1 (HMM E-Value=2.59941e-42) Length = 347 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 232 AYLRRNFVRWSWFKRICCLGTPLPGPSTSARVWSITSTTLTNF 104 AY+ R++ WS+ K C + P+ S S + +IT TL + Sbjct: 87 AYIIRDYFSWSFGKIACQIIIPMNDVSFSVSICTITVITLERY 129 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 202 SISQNSASNTRSQPLLVFEESVDRC*TQ*KMDRKSMGPEVSEQREARTNDRLR*VQVN 375 S+ ++S S+ EE D + K+D K +V++ RE ND+L + VN Sbjct: 1680 SVLESSGGTMNSEESFFLEE--DNAILKRKLDEKETALKVTQDREREMNDKLMALYVN 1735 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.3 bits (60), Expect = 5.5 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 169 PLPGPSTSARVWSITSTTLTNFPFK--GPSADQGDTPWFYVPCKR 41 P PS +RV T+ ++ P+ GPS +GDTP+ P R Sbjct: 827 PPEEPSNKSRVIDRTTVPMSRPPYDVVGPSPVRGDTPYDTSPLSR 871 >SB_9321| Best HMM Match : DDE (HMM E-Value=5.40004e-41) Length = 700 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 256 QRRVGAVNAYLRRNFVRWSWFKRICCLGTPLPGP 155 ++RV +AY N + W W++R+ G + GP Sbjct: 121 RKRVCTRSAYSDINRLAWQWYERMRAQGNQISGP 154 >SB_38407| Best HMM Match : DDE (HMM E-Value=5.40004e-41) Length = 700 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 256 QRRVGAVNAYLRRNFVRWSWFKRICCLGTPLPGP 155 ++RV +AY N + W W++R+ G + GP Sbjct: 121 RKRVCTRSAYSDINRLAWQWYERMRAQGNQISGP 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,962,115 Number of Sequences: 59808 Number of extensions: 387118 Number of successful extensions: 1083 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -