BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0310 (635 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 3.5 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 3.5 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 3.5 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 4.6 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 24 4.6 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 24 4.6 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 4.6 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 4.6 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 8.1 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 210 PPPPPTTTTTVWIDPTATTTTHVP 233 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHVP 234 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHVP 234 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 210 PPPPPTTTTTVWIDPTATTTTHAP 233 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.8 bits (49), Expect = 4.6 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 169 PLPGPSTSARVW-SITSTTLTNFP 101 P P P+T+ VW T+TT T+ P Sbjct: 211 PPPPPTTTTTVWIDPTATTTTHAP 234 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.0 bits (47), Expect = 8.1 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -2 Query: 187 ICCLGTPLPGPSTSARVWSITST-TLTNFPFKGPSADQGDTPWFYVPCKR 41 +C L L G + RVW+ T T L + F AD P +V KR Sbjct: 570 VCLLKKSLYGLKQAGRVWNQTITEVLRSLGFHSSEAD----PCLFVKNKR 615 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,840 Number of Sequences: 2352 Number of extensions: 12539 Number of successful extensions: 28 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -