Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0309
         (693 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024200-1|AAF35996.1|  196|Caenorhabditis elegans Hypothetical ...    29   3.2  

>AC024200-1|AAF35996.1|  196|Caenorhabditis elegans Hypothetical
           protein Y71F9AL.11 protein.
          Length = 196

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +2

Query: 110 PYSHSMASCFMLRSPCLTLSQSVSIALSLFFDTSVAYLRDV-TSVKILPYAP 262
           PY H   S F L  P  ++S S+S++LSL    S+++L  +  S+++  ++P
Sbjct: 35  PYLHLQFSIFHLFQPQASISLSLSLSLSL--SLSLSHLSSIQCSIRVRVHSP 84


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,779,972
Number of Sequences: 27780
Number of extensions: 180659
Number of successful extensions: 450
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 438
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 450
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1592382278
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)