Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0307
         (687 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0113 - 19861904-19862197,19862338-19862496,19862580-198638...    31   0.86 

>02_04_0113 -
           19861904-19862197,19862338-19862496,19862580-19863833,
           19864086-19864124
          Length = 581

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 20/70 (28%), Positives = 36/70 (51%)
 Frame = -2

Query: 362 LENLKWTTNKTKAFHFSLHSEILQGIRKCTAQYYSATQTIRILWISLKCIIPFPRATLGY 183
           L NL  + +KT+A      S +++G RK   +    + T  +  +  +CII  P+   G+
Sbjct: 261 LSNLDVSLDKTEA----QQSVVVEGNRKNYLKQAMVSLTSIVRLVMKRCIIALPQEFEGF 316

Query: 182 RSLFILPNKW 153
           + LF+L  K+
Sbjct: 317 KQLFVLNLKY 326


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,322,550
Number of Sequences: 37544
Number of extensions: 259648
Number of successful extensions: 435
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 432
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 435
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1744894544
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)