BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0307 (687 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003140-2|ABR92610.1| 233|Caenorhabditis elegans Hypothetical ... 34 0.11 AF043697-2|AAB97556.1| 820|Caenorhabditis elegans Patched relat... 29 4.1 >AF003140-2|ABR92610.1| 233|Caenorhabditis elegans Hypothetical protein C44E4.8 protein. Length = 233 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = -2 Query: 362 LENLKWTTNKTKAFHFSLHSEILQGIRKCTAQYYSATQTIRILWISL 222 LENL+WT N+ F LHSE+L+ I K YS +T I + S+ Sbjct: 148 LENLEWTFNR-PGFQMRLHSEMLERI-KFDENDYSQMETALIKYCSI 192 >AF043697-2|AAB97556.1| 820|Caenorhabditis elegans Patched related family protein 11 protein. Length = 820 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 227 SLKCIIPFPRATLGYRSLFILPNKWKVH 144 S++C+ PF +G FIL ++WK H Sbjct: 299 SIQCVTPFLVLGIGVDDAFILLHRWKHH 326 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,745,593 Number of Sequences: 27780 Number of extensions: 268374 Number of successful extensions: 467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -