BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0304 (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 30 0.020 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 23 2.3 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 9.5 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.5 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.5 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 29.9 bits (64), Expect = 0.020 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -3 Query: 648 CPCIDSIFSIHK*KYTYNFINRNIIIQCETNIASEKLHFFIYYCESSFQFID 493 C +DS +I YNF+N N E N A L+F + +++ +F+D Sbjct: 386 CAMVDSCSNILTGDQFYNFLNHNFDRHYEENRAPLGLYFHAAWLKNNPEFLD 437 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 116 PLMPKQQDPCPTYGLKHPD 172 P++ + PC + G KHPD Sbjct: 122 PVLVRDGKPCLSGGPKHPD 140 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 386 MPLCSCFYISYTRSIRSLYDL 448 +P C + TR +R+LY L Sbjct: 387 IPYCGKIFNLTTRQVRTLYKL 407 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 141 GSCCFGINGFLC 106 G+C GIN ++C Sbjct: 36 GTCIDGINSYIC 47 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 367 LRSVT*RKHFKIIKRQTFHFTIR 299 L+ +T K F+ ++ TFH T+R Sbjct: 626 LKKIT-GKMFQGVRSPTFHLTVR 647 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,652 Number of Sequences: 336 Number of extensions: 3297 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -