BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0302 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 24 0.79 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 3.2 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.3 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 9.7 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 9.7 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 24.2 bits (50), Expect = 0.79 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = +3 Query: 63 GNDN-AKT*KNQCFISIKCIPHTVN---*AKRYRNKFKSIYLKKKR*RHPYRDISTT 221 GN+N A T N+C ++I+ P T+ A++ R + K ++ +++ ++ + TT Sbjct: 475 GNNNMAATYMNECLLNIQKSPRTLTLGIFAEKLRLETKELFSSQQKTKNNLMKLETT 531 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 3.2 Identities = 16/56 (28%), Positives = 24/56 (42%) Frame = +3 Query: 198 PYRDISTTTKQSLIHTK*GTRRGHLHSASNESETRRLPRLTGITSKPSEPLTRLMI 365 P STTT + TK R HL+S + + + +L +K + T L I Sbjct: 321 PVLSSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSPHQKKLRFHLAKERKASTTLGI 376 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 370 CFPAIRHYSKLYDEFS 417 C P+++H +K +FS Sbjct: 159 CVPSVKHVAKCATDFS 174 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 9.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 450 NNSKWRKKKQFNIDNMNLI 506 NN+ + KK +NI N+ I Sbjct: 104 NNNNYNKKLYYNIINIEQI 122 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 9.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 450 NNSKWRKKKQFNIDNMNLI 506 NN+ + KK +NI N+ I Sbjct: 104 NNNNYNKKLYYNIINIEQI 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,133 Number of Sequences: 438 Number of extensions: 2873 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -