BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0301 (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G6.05 |||Mvp17/PMP22 family|Schizosaccharomyces pombe|chr 1... 27 3.3 SPBC29A3.01 |||heavy metal ATPase |Schizosaccharomyces pombe|chr... 26 5.8 SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosacch... 26 5.8 >SPAC3G6.05 |||Mvp17/PMP22 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 206 Score = 26.6 bits (56), Expect = 3.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 160 WLLKLNWDEPVPCDVAQSWDRFVS 231 WL+ L + P C VA W+ F+S Sbjct: 165 WLMPLQYQMPFACTVAIFWNIFLS 188 >SPBC29A3.01 |||heavy metal ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 904 Score = 25.8 bits (54), Expect = 5.8 Identities = 15/58 (25%), Positives = 20/58 (34%) Frame = +1 Query: 109 GLISPVITIAKILLQKCWLLKLNWDEPVPCDVAQSWDRFVSCLSLLNNITYRAMLCVL 282 G+ PVI I W L + P +F CL L ++ A C L Sbjct: 432 GIFVPVIVALSISTFTFWFLFTKYSSKYPSVFDDPMGKFAVCLKLTISVVVVACPCAL 489 >SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 25.8 bits (54), Expect = 5.8 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +1 Query: 202 VAQSWDRFVSCLSLL---NNITYRAMLCVLNPY 291 +A D+FV +S L +N Y +LCVL PY Sbjct: 421 IATFEDKFVGAISSLVAEDNSLYVTVLCVLAPY 453 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,839,213 Number of Sequences: 5004 Number of extensions: 57780 Number of successful extensions: 134 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -