BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0299 (725 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC119.14 |rti1||Rad22 homolog Rti1|Schizosaccharomyces pombe|c... 27 2.7 SPAC1250.03 |ubc14||ubiquitin conjugating enzyme Ubc14|Schizosac... 27 2.7 SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2||... 26 6.3 >SPBC119.14 |rti1||Rad22 homolog Rti1|Schizosaccharomyces pombe|chr 2|||Manual Length = 371 Score = 27.1 bits (57), Expect = 2.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 638 WDA*ELEITIFGWDGWDGLMGEMH 709 W A EL IFG++GW + ++H Sbjct: 51 WKAIELANEIFGFNGWSSSIQDIH 74 >SPAC1250.03 |ubc14||ubiquitin conjugating enzyme Ubc14|Schizosaccharomyces pombe|chr 1|||Manual Length = 155 Score = 27.1 bits (57), Expect = 2.7 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -1 Query: 716 HFGASLPSTHPIRPIQIW*SLTLRHPTR*A*PSFDVN*KLCF*ILFEIDYKENIKL 549 HF P +P +P T+ TR P+FD +C IL + +K +IKL Sbjct: 57 HFSLKFPLDYPFQPP------TIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKL 106 >SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2|||Manual Length = 1157 Score = 25.8 bits (54), Expect = 6.3 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Frame = +2 Query: 113 LLYIQNFLFN---HSIYLKKPHQNPLRSFKYLSIHREVGTEKANLFYTM*YSDNVLCKEI 283 LL + N FN H +YL SF Y S E+ T N F N +CK+I Sbjct: 1006 LLPLSNCDFNEQKHELYLS---WRTNASFFYASSSLEIDTPCFNDFKKKFLDSNGMCKQI 1062 Query: 284 C 286 C Sbjct: 1063 C 1063 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,032,093 Number of Sequences: 5004 Number of extensions: 61223 Number of successful extensions: 146 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -