BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0299 (725 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK131203-1|BAD18395.1| 430|Homo sapiens 4.1.150). protein. 32 2.4 X91141-1|CAA62580.1| 862|Homo sapiens rabaptin-5 protein. 31 5.6 BC041700-1|AAH41700.1| 862|Homo sapiens RABEP1 protein protein. 31 5.6 BC032435-1|AAH32435.1| 716|Homo sapiens RABEP1 protein protein. 31 5.6 AF098638-1|AAC70781.1| 829|Homo sapiens rabaptin-4 protein. 31 5.6 >AK131203-1|BAD18395.1| 430|Homo sapiens 4.1.150). protein. Length = 430 Score = 31.9 bits (69), Expect = 2.4 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +2 Query: 428 AAVLTIPRP*NSCLKVVGGIYVTESCYEVHVTESLNICLETILYSLCNLFRIVFRST 598 A ++TI + ++++ IYV ++ Y +HV E + +T + +L N F VF S+ Sbjct: 112 AYIITIHKELAMFVQLLRAIYVPQNVYCIHVDEKAPMKYKTAVQTLVNCFENVFISS 168 >X91141-1|CAA62580.1| 862|Homo sapiens rabaptin-5 protein. Length = 862 Score = 30.7 bits (66), Expect = 5.6 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -3 Query: 657 SNSQASHQVSMTFLRCQLKAVLLNTIRNRLQREYKIVSKQM 535 S+ +SHQ+S LR Q +LL ++ L + + V +QM Sbjct: 588 SSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQM 628 >BC041700-1|AAH41700.1| 862|Homo sapiens RABEP1 protein protein. Length = 862 Score = 30.7 bits (66), Expect = 5.6 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -3 Query: 657 SNSQASHQVSMTFLRCQLKAVLLNTIRNRLQREYKIVSKQM 535 S+ +SHQ+S LR Q +LL ++ L + + V +QM Sbjct: 588 SSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQM 628 >BC032435-1|AAH32435.1| 716|Homo sapiens RABEP1 protein protein. Length = 716 Score = 30.7 bits (66), Expect = 5.6 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -3 Query: 657 SNSQASHQVSMTFLRCQLKAVLLNTIRNRLQREYKIVSKQM 535 S+ +SHQ+S LR Q +LL ++ L + + V +QM Sbjct: 581 SSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQM 621 >AF098638-1|AAC70781.1| 829|Homo sapiens rabaptin-4 protein. Length = 829 Score = 30.7 bits (66), Expect = 5.6 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -3 Query: 657 SNSQASHQVSMTFLRCQLKAVLLNTIRNRLQREYKIVSKQM 535 S+ +SHQ+S LR Q +LL ++ L + + V +QM Sbjct: 588 SSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQM 628 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,450,297 Number of Sequences: 237096 Number of extensions: 2242458 Number of successful extensions: 3213 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3213 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8567175942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -