BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0299 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 9.0 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 552 FYILFVIYFE*YLEAQLSIDIEGRSC 629 +YI+ + + YL L ID+ R+C Sbjct: 114 YYIIILAWALFYLLVSLRIDLPWRTC 139 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 552 FYILFVIYFE*YLEAQLSIDIEGRSC 629 +YI+ + + YL L ID+ R+C Sbjct: 167 YYIIILAWALFYLLVSLRIDLPWRTC 192 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = -2 Query: 724 ITSILVHLSHQPIPSVPSKYGNL*LSGIPPGKHDLPSMSIESC 596 + + H +P+ V + L P +LP SI SC Sbjct: 389 VVGFMAHEQQKPVADVAASGPGLAFLVYPSAVLELPGSSIWSC 431 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +2 Query: 122 IQNFLFNHSIYLKKPHQ 172 +Q+F+ HS+YL++ Q Sbjct: 88 LQSFMQQHSLYLQQQQQ 104 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 622 GHAYLVGCLRVRDYHIWMGRMGWV 693 G AY V C RD +I ++ W+ Sbjct: 539 GDAYCVACGLHRDTYIHAQQIAWM 562 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,786 Number of Sequences: 438 Number of extensions: 4175 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -