BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0298 (715 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81110-1|CAB03258.2| 322|Caenorhabditis elegans Hypothetical pr... 28 7.6 AF370362-1|AAK52515.1| 322|Caenorhabditis elegans putative tran... 28 7.6 >Z81110-1|CAB03258.2| 322|Caenorhabditis elegans Hypothetical protein T01D3.2 protein. Length = 322 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +2 Query: 509 AYKTLVN-FYASENVKELALSTLVDVKEAVVAKKL 610 A++ L N FY N+K ++L +L+D+ ++ V K+ Sbjct: 234 AHQLLNNPFYPDSNIKGMSLYSLIDISDSEVISKM 268 >AF370362-1|AAK52515.1| 322|Caenorhabditis elegans putative transcription factor T01D3.2protein. Length = 322 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +2 Query: 509 AYKTLVN-FYASENVKELALSTLVDVKEAVVAKKL 610 A++ L N FY N+K ++L +L+D+ ++ V K+ Sbjct: 234 AHQLLNNPFYPDSNIKGMSLYSLIDISDSEVISKM 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,310,141 Number of Sequences: 27780 Number of extensions: 324235 Number of successful extensions: 657 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1666201324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -