BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0296 (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_45206| Best HMM Match : SAM_2 (HMM E-Value=2.8e-05) 27 9.5 >SB_9670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 87 FMVVCRHCFFNPLFVCSLLIQHLRSILIRKIPNDLYS-TVTKVH 215 F+ CR PL +C L+ L+ +R +P+ L+S +TK H Sbjct: 407 FLQNCRGNKKKPLKLCPLVKNRLKDFSLRNLPSVLWSLDITKKH 450 >SB_45206| Best HMM Match : SAM_2 (HMM E-Value=2.8e-05) Length = 169 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 572 ANQAHNAFRVTCYTL*YD 519 +N AH+A + TCYT YD Sbjct: 26 SNPAHSALQYTCYTFVYD 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,033,971 Number of Sequences: 59808 Number of extensions: 371877 Number of successful extensions: 643 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -