BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0296 (629 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81491-12|CAI46569.1| 177|Caenorhabditis elegans Hypothetical p... 27 8.4 AL117202-3|CAB55094.2| 691|Caenorhabditis elegans Hypothetical ... 27 8.4 >Z81491-12|CAI46569.1| 177|Caenorhabditis elegans Hypothetical protein D1086.10a protein. Length = 177 Score = 27.5 bits (58), Expect = 8.4 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 181 PTTCTVLSPKSMDVKYKWEKTIPPYLV 261 PT+ T +P + ++ ++W T PP +V Sbjct: 71 PTSTTTTAPGTTELPFEWNVTAPPSVV 97 >AL117202-3|CAB55094.2| 691|Caenorhabditis elegans Hypothetical protein Y47D3A.4 protein. Length = 691 Score = 27.5 bits (58), Expect = 8.4 Identities = 19/75 (25%), Positives = 34/75 (45%) Frame = -2 Query: 529 SSTILVP*FSYPGPIYVNRFLRSKLQKKLTAAASRGLY*AKR*SYSMSYMFSKCYNCYFL 350 +ST+LVP G VN+ ++ L +A + Y +S + + C + Sbjct: 84 NSTLLVP-MGVLGQEEVNKIKEIAEEENLLSAVNN--YGGDHHKSDLSNVLNYCKRVFAS 140 Query: 349 CNNI*RQTIFIITNN 305 C+N Q++ +TNN Sbjct: 141 CSNTRHQSVIYLTNN 155 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,197,786 Number of Sequences: 27780 Number of extensions: 292718 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -