BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0295 (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL121993-4|CAI22739.1| 943|Homo sapiens WD repeat domain 3 prot... 77 6e-14 AF083217-1|AAD45865.1| 943|Homo sapiens WD repeat protein WDR3 ... 77 6e-14 BC058836-1|AAH58836.1| 40|Homo sapiens WDR3 protein protein. 31 2.9 BC032685-1|AAH32685.1| 662|Homo sapiens EML5 protein protein. 31 5.0 >AL121993-4|CAI22739.1| 943|Homo sapiens WD repeat domain 3 protein. Length = 943 Score = 77.0 bits (181), Expect = 6e-14 Identities = 34/58 (58%), Positives = 40/58 (68%) Frame = +3 Query: 81 MGLTKQYLRYAPTGSFNIIASADCNSTHVTLNGISGRYIAVGACEHVIIWDMKLGEKV 254 MGLTKQYLRY + F +I S N VTL G GRY+AV ACEHV IWD++ GEK+ Sbjct: 1 MGLTKQYLRYVASAVFGVIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKI 58 >AF083217-1|AAD45865.1| 943|Homo sapiens WD repeat protein WDR3 protein. Length = 943 Score = 77.0 bits (181), Expect = 6e-14 Identities = 34/58 (58%), Positives = 40/58 (68%) Frame = +3 Query: 81 MGLTKQYLRYAPTGSFNIIASADCNSTHVTLNGISGRYIAVGACEHVIIWDMKLGEKV 254 MGLTKQYLRY + F +I S N VTL G GRY+AV ACEHV IWD++ GEK+ Sbjct: 1 MGLTKQYLRYVASAVFGVIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKI 58 >BC058836-1|AAH58836.1| 40|Homo sapiens WDR3 protein protein. Length = 40 Score = 31.5 bits (68), Expect = 2.9 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 Query: 81 MGLTKQYLRYAPTGSFNIIAS 143 MGLTKQYLRY + F +I S Sbjct: 1 MGLTKQYLRYVASAVFGVIGS 21 >BC032685-1|AAH32685.1| 662|Homo sapiens EML5 protein protein. Length = 662 Score = 30.7 bits (66), Expect = 5.0 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 102 LRYAPTGSFNIIASADCNSTHVTLNGISGRYIAVGAC 212 L+Y+P G++ + CN + V + G++ RY VG C Sbjct: 414 LKYSPDGTYLAVG---CNDSSVDIYGVAQRYKKVGEC 447 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,180,229 Number of Sequences: 237096 Number of extensions: 1931772 Number of successful extensions: 8293 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8293 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -