BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0295 (685 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23139-7|AAK31492.1| 929|Caenorhabditis elegans Hypothetical pr... 40 0.001 U28736-2|AAA68307.1| 620|Caenorhabditis elegans Hypothetical pr... 28 5.4 Z49912-9|CAA90141.2| 1067|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z49912-8|CAE54898.1| 1067|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z49907-13|CAA90091.2| 1067|Caenorhabditis elegans Hypothetical p... 28 7.1 Z49907-12|CAE54883.1| 1067|Caenorhabditis elegans Hypothetical p... 28 7.1 AF043702-9|ABD94093.1| 237|Caenorhabditis elegans Hypothetical ... 27 9.4 >U23139-7|AAK31492.1| 929|Caenorhabditis elegans Hypothetical protein F13H8.2 protein. Length = 929 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/59 (38%), Positives = 34/59 (57%) Frame = +3 Query: 81 MGLTKQYLRYAPTGSFNIIASADCNSTHVTLNGISGRYIAVGACEHVIIWDMKLGEKVD 257 MGLTK YL+Y GS + SA+ L I G+ +AV A E++ ++M+ EKV+ Sbjct: 1 MGLTKDYLKYEHAGSCGCVGSANGQ-----LVAIDGQTVAVSANEYLNFYNMRTAEKVN 54 >U28736-2|AAA68307.1| 620|Caenorhabditis elegans Hypothetical protein F26A10.2 protein. Length = 620 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 386 FQCKFCFTKNYTFNSNI 336 F+CKFCF K Y F SN+ Sbjct: 76 FKCKFCF-KTYKFRSNL 91 >Z49912-9|CAA90141.2| 1067|Caenorhabditis elegans Hypothetical protein T24F1.6a protein. Length = 1067 Score = 27.9 bits (59), Expect = 7.1 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +1 Query: 391 LLYKCYLISPQNYWLNIFYANHFN 462 ++Y +SP +Y+ +++ NHFN Sbjct: 257 MMYILSTLSPNDYFFGVYFNNHFN 280 >Z49912-8|CAE54898.1| 1067|Caenorhabditis elegans Hypothetical protein T24F1.6b protein. Length = 1067 Score = 27.9 bits (59), Expect = 7.1 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +1 Query: 391 LLYKCYLISPQNYWLNIFYANHFN 462 ++Y +SP +Y+ +++ NHFN Sbjct: 257 MMYILSTLSPNDYFFGVYFNNHFN 280 >Z49907-13|CAA90091.2| 1067|Caenorhabditis elegans Hypothetical protein T24F1.6a protein. Length = 1067 Score = 27.9 bits (59), Expect = 7.1 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +1 Query: 391 LLYKCYLISPQNYWLNIFYANHFN 462 ++Y +SP +Y+ +++ NHFN Sbjct: 257 MMYILSTLSPNDYFFGVYFNNHFN 280 >Z49907-12|CAE54883.1| 1067|Caenorhabditis elegans Hypothetical protein T24F1.6b protein. Length = 1067 Score = 27.9 bits (59), Expect = 7.1 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +1 Query: 391 LLYKCYLISPQNYWLNIFYANHFN 462 ++Y +SP +Y+ +++ NHFN Sbjct: 257 MMYILSTLSPNDYFFGVYFNNHFN 280 >AF043702-9|ABD94093.1| 237|Caenorhabditis elegans Hypothetical protein W03D8.11 protein. Length = 237 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 300 KYINNRPRIKGIYIYLP 250 K++NNR I GIY+ LP Sbjct: 94 KFVNNRKEINGIYLPLP 110 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,296,035 Number of Sequences: 27780 Number of extensions: 334303 Number of successful extensions: 685 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -