BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0293 (692 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyce... 29 0.84 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 28 1.1 SPBP16F5.02 |mcs2||cyclin Mcs2|Schizosaccharomyces pombe|chr 2||... 28 1.1 SPAC23H4.17c |srb10|prk1, cdk8|cyclin-dependent protein kinase S... 27 1.9 SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalyti... 26 4.5 SPBP35G2.11c |||transcription related zf-ZZ type zinc finger pro... 26 4.5 SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 26 5.9 >SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 747 Score = 28.7 bits (61), Expect = 0.84 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +2 Query: 278 INLQKYIRCLVHVFFKLFYIEALMELVYIFLILNLHSDM---YFLKKANLLQ 424 I+ QKY C++ + LF + + I + N H D+ + LKK +L+ Sbjct: 242 ISPQKYFSCILPQVWSLFSTQPRLASQLIIAVTNTHCDIVTSFLLKKLQILE 293 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 28.3 bits (60), Expect = 1.1 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 521 SPKPKGTKFNTNL-LITIFTKEFSNEH 444 SP P T F+TN +IT+F KE +NEH Sbjct: 1738 SPPPIHTNFDTNADIITLFEKE-ANEH 1763 >SPBP16F5.02 |mcs2||cyclin Mcs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 322 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 365 FLILNLHSDMYFLKKANLLQNSSLY 439 FLI LHSD+YFL +++ ++Y Sbjct: 201 FLIETLHSDIYFLHSPSIIALGAIY 225 >SPAC23H4.17c |srb10|prk1, cdk8|cyclin-dependent protein kinase Srb10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 352 Score = 27.5 bits (58), Expect = 1.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 312 WTRQRIYFCKLMKMKTNHLIMMHSLNHF 229 WT + ++F L ++ N L++ H L HF Sbjct: 325 WTTRYVFFLFLFIIERNKLLLTHFLAHF 352 >SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalytic subunit Cdc6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 26.2 bits (55), Expect = 4.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 561 SYVFYKSLKPNIYYMRSESTIVVLATHVCI 650 +YV K + + +YMRSE I VL ++ I Sbjct: 906 AYVIIKGAQGDQFYMRSEDPIYVLENNIPI 935 >SPBP35G2.11c |||transcription related zf-ZZ type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 26.2 bits (55), Expect = 4.5 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = -3 Query: 270 KTNHLIMMHSLNHFSFV*CKIISMSV----NYKFQIIDHCNQCANAH*LKC 130 K + +++ S+ + + C + SMSV N+ + I DHC Q + KC Sbjct: 100 KPHFVLVRSSIPSVASLTCSVNSMSVSPQSNFMYAICDHCEQPIHNVRYKC 150 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 415 LITKFFSLYLCSLLNSLVKIVISKFVLNLVPFGFGLISNVFCFFLLFYLVMCFI 576 +I +FS+ + S ++ + +K +LNLV L LLF +++C + Sbjct: 430 VILLYFSILMDDFYTSAIQAMATKLILNLVERIVALEDFSTSRSLLFAILLCLL 483 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,484,791 Number of Sequences: 5004 Number of extensions: 48389 Number of successful extensions: 116 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -