BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0293 (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32590| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_31804| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_32590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 433 SLYLCSLLNSLVKI---VISKFVLNLVPFGFGLISNVFCFFL 549 SLYL LL SLV++ + S + +NL+ GF LI+ + C L Sbjct: 238 SLYLNFLLASLVELPGNLFSIWFMNLLMAGFALIAGLLCLLL 279 >SB_31804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2047 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -1 Query: 446 HKYKEKNFVIS*PFLRNTCRNVNLKLKKYKPTPSMPLYKII*KKHGPDNEYTFV 285 H Y +++F R + + + + Y+P P L+KI+ G D EY FV Sbjct: 690 HAYFKRHFTNE--EFREVRKILEILIATYEPLPVKELFKILQNSDGLDYEYDFV 741 >SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/50 (24%), Positives = 28/50 (56%) Frame = +1 Query: 463 LVKIVISKFVLNLVPFGFGLISNVFCFFLLFYLVMCFINL*NLIYIICEV 612 ++ I+I ++ ++ ++ + F++ +V CFIN IY+IC++ Sbjct: 13 IIIIIIIIIIIIIIVIIIVIVVVIIIIFIVVVVVFCFIN----IYVICDI 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,357,376 Number of Sequences: 59808 Number of extensions: 310520 Number of successful extensions: 604 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -