BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0291 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 27 0.11 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 27 0.11 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 27 0.11 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 25 0.77 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 5.4 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.2 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 27.5 bits (58), Expect = 0.11 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 31 CEVEPSDKIEIEQLSAATGRILNDYLYLSRV 123 C + PS+ E +QLS G + +YL L ++ Sbjct: 3 CPLRPSEAQEGDQLSEECGMLYGEYLMLDKI 33 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.5 bits (58), Expect = 0.11 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 31 CEVEPSDKIEIEQLSAATGRILNDYLYLSRV 123 C + PS+ E +QLS G + +YL L ++ Sbjct: 3 CPLRPSEAQEGDQLSEECGMLYGEYLMLDKI 33 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.5 bits (58), Expect = 0.11 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 31 CEVEPSDKIEIEQLSAATGRILNDYLYLSRV 123 C + PS+ E +QLS G + +YL L ++ Sbjct: 3 CPLRPSEAQEGDQLSEECGMLYGEYLMLDKI 33 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 24.6 bits (51), Expect = 0.77 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 349 NLGTAIRPHGLGFKITTVVLIIIFI 423 +LG + P L FK+ T+V I I I Sbjct: 13 SLGNTVTPVSLRFKLYTIVHIFIII 37 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 208 GDTMAAWCNFSVRQDCSR 155 G + + WCN+S SR Sbjct: 141 GFSSSTWCNYSAYSSASR 158 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 154 PPNVP*TNSHKLEININ 104 PPN P H EIN N Sbjct: 697 PPNFPTCGDHVPEINSN 713 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,551 Number of Sequences: 336 Number of extensions: 3230 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -