BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0290 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 26 1.3 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 25 3.0 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 5.2 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 5.2 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 5.2 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 5.2 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 5.2 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 5.2 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 5.2 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 5.2 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 5.2 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 5.2 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 5.2 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 5.2 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 5.2 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 5.2 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 5.2 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 5.2 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 5.2 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 5.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.2 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 269 MVPSLSATPLHWLKRRHQQSSSLMN-WTLLVQSVLIQKRLETV 394 +VPS+ + W R HQ +L++ W L+ + ++ LE + Sbjct: 503 VVPSIRSAASEWNPRAHQPMIALLDAWAPLLPAWILDNVLEQI 545 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 571 LARASSLG*GNSIFRSKRPDLAGQGPKCPLYW 476 ++R S G GN+ KR + +GP P W Sbjct: 70 ISRRSGDGNGNAGMVEKRTSMVDEGPLVPYPW 101 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 161 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 194 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 86 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 119 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 86 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 119 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 86 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 119 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 86 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 119 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 552 NEEARARIMQIHSRKMNVSPDVNFEELSRSTDDFQ 656 +E R+R+ + K+N VNF EL+ S+D + Sbjct: 86 DEGCRSRVQYL-DLKLNEIDTVNFAELAASSDTLE 119 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 308 LANAKASRTSLAPSPMNIAQVVDQP 234 L N S + +P P+NIA++V +P Sbjct: 2332 LFNLLLSLETPSPDPLNIAELVKEP 2356 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 823,425 Number of Sequences: 2352 Number of extensions: 18061 Number of successful extensions: 65 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -