BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0284 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0273 + 1822370-1822503,1822913-1823258,1823393-1823635,182... 31 0.87 03_01_0309 - 2432395-2433271,2433494-2434495,2434538-2435073,243... 28 8.1 >02_01_0273 + 1822370-1822503,1822913-1823258,1823393-1823635, 1824212-1824268,1824407-1824487,1824725-1824786, 1824990-1826004 Length = 645 Score = 31.1 bits (67), Expect = 0.87 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 452 RNNSRSGYWEYDFLASSINNFYHRNFLINVVESQWIVIIFRK 577 R +S WEY + S N H + I+ +ES+W +FR+ Sbjct: 526 RMELQSIMWEYVGIVRSTNRLKHAEWKISDLESEWEEFLFRR 567 >03_01_0309 - 2432395-2433271,2433494-2434495,2434538-2435073, 2435579-2435716,2436050-2436148,2436278-2436346, 2436968-2437063 Length = 938 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 513 KLFMLDARKSYSQ*PDLELFLSTQFKNIYHREFVNLFLNIKFWSFY 376 K FM+ A S + + E+FL +N++H F+ L + + W F+ Sbjct: 475 KTFMIAASSSSAAWSEFEVFL---LENLFHPHFLCLEILTELWCFF 517 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,988,617 Number of Sequences: 37544 Number of extensions: 256036 Number of successful extensions: 376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -