BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0281 (727 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 33 0.19 At5g54050.1 68418.m06722 DC1 domain-containing protein 32 0.45 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 32 0.45 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 31 0.59 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 31 0.59 At3g21270.1 68416.m02688 Dof-type zinc finger domain-containing ... 31 1.0 At2g41210.1 68415.m05089 phosphatidylinositol-4-phosphate 5-kina... 31 1.0 At1g61080.1 68414.m06877 proline-rich family protein 29 2.4 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 4.1 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 4.1 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 29 4.1 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 29 4.1 At3g63070.1 68416.m07084 PWWP domain-containing protein putative... 28 5.5 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 28 7.2 At3g63180.1 68416.m07097 expressed protein 28 7.2 At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain... 28 7.2 At1g59453.1 68414.m06679 transcription factor-related weak simil... 28 7.2 At1g49475.1 68414.m05545 transcriptional factor B3 family protei... 28 7.2 At5g54062.1 68418.m06725 hypothetical protein 27 9.6 At4g02650.1 68417.m00360 epsin N-terminal homology (ENTH) domain... 27 9.6 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 27 9.6 At2g46700.1 68415.m05827 calcium-dependent protein kinase, putat... 27 9.6 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 27 9.6 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 27 9.6 At1g55370.2 68414.m06331 expressed protein 27 9.6 At1g55370.1 68414.m06330 expressed protein 27 9.6 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 27 9.6 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 33.1 bits (72), Expect = 0.19 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -2 Query: 273 PPPPPFANHDVRPAHTVGPEGQIFRRHPRQ*DDIPPPHQDG--TRSCRLHPRTSL 115 P PPP ++D RP + P+ + R + R+ D++PPP + S RL P L Sbjct: 569 PLPPPARSYDRRPPVPLYPKASLKRDYDRR-DELPPPRSRPAVSYSSRLSPERHL 622 >At5g54050.1 68418.m06722 DC1 domain-containing protein Length = 580 Score = 31.9 bits (69), Expect = 0.45 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -1 Query: 718 QIWHNGLIYKCITWECQNRLVFIIR-DYLSKPFRSDI 611 +I+ +G IY+C+ +C+N+ + +R +S+PF D+ Sbjct: 383 RIYTDGFIYECLHEDCENKNAYDVRCSSVSEPFHHDL 419 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 31.9 bits (69), Expect = 0.45 Identities = 30/92 (32%), Positives = 37/92 (40%), Gaps = 9/92 (9%) Frame = -2 Query: 507 GLRRPIWRSSPMTPPSTTRVGRRRCFIDDFRPQLPPWDSGSGS---GASTLTPR------ 355 G +R P PP TR+ +C P PP S SGS G + P Sbjct: 632 GNKRQAQPPPPPPPPPPTRIPAAKCAPP---PPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Query: 354 KAQRCSSKGVALRTPR*ASLSRLGASTPPPPP 259 KA ++ P S +RLGA PPPPP Sbjct: 689 KANISNAPKPPAPPPLPPSSTRLGAPPPPPPP 720 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 31.5 bits (68), Expect = 0.59 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = -2 Query: 393 SGSGSGASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASTPPPPP 259 S S S + PRK R S LR R +S S +S PPPPP Sbjct: 359 SYSSSPSPRRIPRKISRSRSPKRPLRGKRSSSNSSSSSSPPPPPP 403 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 31.5 bits (68), Expect = 0.59 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = -2 Query: 393 SGSGSGASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASTPPPPP 259 S S S + PRK R S LR R +S S +S PPPPP Sbjct: 366 SYSSSPSPRRIPRKISRSRSPKRPLRGKRSSSNSSSSSSPPPPPP 410 >At3g21270.1 68416.m02688 Dof-type zinc finger domain-containing protein (ADOF2) identical to Dof zinc finger protein ADOF2 GI:3608263 from [Arabidopsis thaliana]; identical to cDNA adof2 mRNA for Dof zinc finger protein GI:3608262; contains Pfam profile PF02701: Dof domain, zinc finger Length = 204 Score = 30.7 bits (66), Expect = 1.0 Identities = 21/70 (30%), Positives = 35/70 (50%) Frame = +2 Query: 419 KSSMKQRLLPTRVVDGGVIGEERQMGLRRPGISLIYKLNSNGERAELAGXRL*RDGAGNA 598 ++S K L PTR++ G IG++ G+ G L +N + L G + DG+G Sbjct: 115 RNSQKPDLDPTRMLYGFPIGDQDVKGMEIGG--SFSSLLANNMQLGLGGGGIMLDGSGWD 172 Query: 599 FPRLDIGTKR 628 P + +G +R Sbjct: 173 HPGMGLGLRR 182 >At2g41210.1 68415.m05089 phosphatidylinositol-4-phosphate 5-kinase family protein similar to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 772 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 261 PFANHDVRPAHTVGPEGQIFRRHPRQ*DDIPPPHQ 157 P A+ D++P+ P+ +I+RR PR+ PPHQ Sbjct: 402 PAASLDLKPS-AFDPKDKIWRRFPREGTKYTPPHQ 435 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/60 (31%), Positives = 25/60 (41%) Frame = -2 Query: 414 PQLPPWDSGSGSGASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASTPPPPPFANHDVRP 235 P PP +G+ P A + G PR + GA+ PPPPP A +RP Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMAN--GAAGPPPPPGAARSLRP 649 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/54 (33%), Positives = 22/54 (40%) Frame = -2 Query: 273 PPPPPFANHDVRPAHTVGPEGQIFRRHPRQ*DDIPPPHQDGTRSCRLHPRTSLP 112 PPPPP + H V H + P G + P PPP S P+ S P Sbjct: 618 PPPPPGSYHPVHGQH-MPPYGMQYPPPPPHVTQAPPPGTTQNPSSS-EPQQSFP 669 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/54 (33%), Positives = 22/54 (40%) Frame = -2 Query: 273 PPPPPFANHDVRPAHTVGPEGQIFRRHPRQ*DDIPPPHQDGTRSCRLHPRTSLP 112 PPPPP + H V H + P G + P PPP S P+ S P Sbjct: 618 PPPPPGSYHPVHGQH-MPPYGMQYPPPPPHVTQAPPPGTTQNPSSS-EPQQSFP 669 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 285 GASTPPPPPFANHDVRPAHTVGPEG 211 G PPPPP AN+ RP G G Sbjct: 249 GLFPPPPPPMANNGFRPMPPAGGFG 273 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 28.7 bits (61), Expect = 4.1 Identities = 20/67 (29%), Positives = 24/67 (35%) Frame = -3 Query: 407 YHHGTVVPEVAHRH*PHEKHSGALQKGSPSEHHAEHPSPD*ARQHPRPRRSPITMFDQPI 228 YHHG P H H PH SP + + P A+ +P P T Sbjct: 43 YHHGHHHPHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKP 102 Query: 227 PWAPKVK 207 P P VK Sbjct: 103 PTKPPVK 109 >At3g63070.1 68416.m07084 PWWP domain-containing protein putative transcription factor HUA2, Arabidopsis thaliana, EMBL:AF116556 Length = 1347 Score = 28.3 bits (60), Expect = 5.5 Identities = 22/72 (30%), Positives = 35/72 (48%) Frame = -2 Query: 405 PPWDSGSGSGASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASTPPPPPFANHDVRPAHT 226 PPW+ G S AS +T + R S+ L P S + +S+PP P N + +++ Sbjct: 1092 PPWEGG--SSASAITDQADNRESAN--CLLVPG-TSHQNVTSSSPPARPSQNAQLAMSNS 1146 Query: 225 VGPEGQIFRRHP 190 G +RR+P Sbjct: 1147 YS-NGFDYRRNP 1157 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 331 RGRPPNTTLSIPLPTRRVNTPAPAVRQSRCSTSPYRGPRR-SNI*ASPS 188 + RPP+ +PLP P+ + SR +P+ PR S++ PS Sbjct: 21 KNRPPSPPPPLPLPPSPSPPPSQQMSSSRQKNTPFLFPRSDSSVLPDPS 69 >At3g63180.1 68416.m07097 expressed protein Length = 978 Score = 27.9 bits (59), Expect = 7.2 Identities = 33/131 (25%), Positives = 49/131 (37%), Gaps = 2/131 (1%) Frame = -1 Query: 595 VPGPVTSQPXSRKLRPLPVTIQFVYQRYTRSPETHLALFADDTAIYYSCRKKALLHRRLQ 416 VP P P + L+P+ V + R T+SP HLA+ + + + Sbjct: 536 VPAPAFIYPANHHLQPVMVPSKS--SRPTKSP--HLAVGLASANFSHPSSSASEVSSPYL 591 Query: 415 TAATTMGQWFRKWRIDINPTKSTAVLFKRGR--PPNTTLSIPLPTRRVNTPAPAVRQSRC 242 T F+ T S AV F G P P P +R + + S C Sbjct: 592 TVIPNNAYSFQLSSTIRGGTPSQAVPFYNGSFYSPQMFQQPPQPLQRQSQAQRESKASSC 651 Query: 241 STSPYRGPRRS 209 S+S +R P+ S Sbjct: 652 SSSSHRQPQVS 662 >At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 174 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = -1 Query: 382 KWRIDINPTKSTAVLFKRGRPPNTTLSIPLPTRRVNTPAPAVRQSRCSTSPYRGPRRS 209 K + ++P KST PP+TT S +R + P+P+ ++ C + R R + Sbjct: 100 KIHVFLSPLKSTRTTANSSPPPSTTSSSSSKSRSRSPPSPSTPET-CPSCVERSIRNN 156 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 453 RVGRRRCFIDDFRPQLPPWDSGSGS 379 RV CF+ D+ LP WDS S S Sbjct: 649 RVKLLHCFLWDYFSSLPGWDSASSS 673 >At1g49475.1 68414.m05545 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 250 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 616 DIESRERVPGPVTSQPXSRKLRPLP 542 ++ + R PGP+TS R+L+P P Sbjct: 3 NMHTNRRSPGPITSAATQRRLKPEP 27 >At5g54062.1 68418.m06725 hypothetical protein Length = 207 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 587 PRHVTAXFPQAPPSPRYYSVCISTIYPVSG 498 P H T FP P SP + C+S++ V G Sbjct: 116 PAHKTPQFPVIPGSPIDLTKCLSSLVNVQG 145 >At4g02650.1 68417.m00360 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Chain A, Calm-N N-Terminal Domain Of Clathrin Assembly Lymphoid Myeloid Leukaemia Protein, Pi(4,5)p2 Complex (GP:13399999) {Homo sapiens}; supporting cDNA gi|26451912|dbj|AK118440.1| Length = 611 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 236 GRTS*LANGGGGGVDAPSRERDAQRG 313 GR +GGGGG D S E D RG Sbjct: 158 GRRGKKKSGGGGGGDGDSGEEDDHRG 183 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 322 PPNTTLSIPLPTRRVNTPAPAVRQSRCSTSPYRGP 218 PP T S+P PT V+ P P S S +P P Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 135 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 322 PPNTTLSIPLPTRRVNTPAPAVRQSRCSTSPYRGP 218 PP T S+P PT V+ P P S S +P P Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 >At2g46700.1 68415.m05827 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase homolog MCK1 [Zea mays] gi|1839597|gb|AAB47181 Length = 595 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = -3 Query: 326 SPSEHHAEHPSPD*ARQHPRPRRSPITMFDQPIPWAPKVKYLGVTLDSRMTFRP 165 SP H + P P P +P F +P P K++ +L R+ +P Sbjct: 59 SPFPHGSASPLPSGVSPSPARTSTPRRFFRRPFPPPSPAKHIKASLIKRLGVKP 112 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.5 bits (58), Expect = 9.6 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 7/63 (11%) Frame = -1 Query: 298 PLPTRRVNTPAPAVRQSRCSTSP---YRGP----RRSNI*ASPSTVG*HSAPTSRRYAIV 140 P P+RR +P+P R+ R + P R P RR P+ +P +RR+ Sbjct: 304 PAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPARRHRSPTPPARQRRSPSPPARRHRSP 363 Query: 139 PPS 131 PP+ Sbjct: 364 PPA 366 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 27.5 bits (58), Expect = 9.6 Identities = 21/86 (24%), Positives = 29/86 (33%) Frame = -2 Query: 420 FRPQLPPWDSGSGSGASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASTPPPPPFANHDV 241 FR PP S P + + S A P + +S + PPPPP ++ Sbjct: 452 FRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEP 511 Query: 240 RPAHTVGPEGQIFRRHPRQ*DDIPPP 163 P R +P PPP Sbjct: 512 SPPPPSSEMSPSVRAYPPPPPLSPPP 537 >At1g55370.2 68414.m06331 expressed protein Length = 354 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 718 QIWHNGLIYKCITWECQNRLVFIIRDYLSKPFRS 617 ++WH G + TW Q +IR +S FRS Sbjct: 110 RVWHGGKVELLHTWVEQEEEEVVIRGGVSSAFRS 143 >At1g55370.1 68414.m06330 expressed protein Length = 308 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 718 QIWHNGLIYKCITWECQNRLVFIIRDYLSKPFRS 617 ++WH G + TW Q +IR +S FRS Sbjct: 110 RVWHGGKVELLHTWVEQEEEEVVIRGGVSSAFRS 143 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 276 TPPPPPFANHDVRPAHTVGPEGQIFRRHP 190 +PPPPP+ + +PA+ P ++ P Sbjct: 566 SPPPPPYYSPSPKPAYKSSPPPYVYSSPP 594 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,006,229 Number of Sequences: 28952 Number of extensions: 457756 Number of successful extensions: 1823 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1789 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -