BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0279 (685 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0283 - 26917676-26917714,26917987-26918058,26918160-269182... 51 1e-06 >05_06_0283 - 26917676-26917714,26917987-26918058,26918160-26918251, 26918500-26918524 Length = 75 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/61 (42%), Positives = 37/61 (60%) Frame = +2 Query: 260 RPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVKFDRRRAALDSD 439 +P+KA +E+++ R AQ G I K++E LI +LE N K Q+ V RRR+ LD D Sbjct: 16 KPDKARGVEDVLLRAAQSGGISEKVSEERLISLLEQINTHTSK-QTKVTIQRRRSVLDDD 74 Query: 440 D 442 D Sbjct: 75 D 75 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,266,626 Number of Sequences: 37544 Number of extensions: 258092 Number of successful extensions: 452 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -