BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0277 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizo... 25 7.8 SPAPJ695.01c |||S. pombe specific UPF0321 family protein 3|Schiz... 25 7.8 >SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.4 bits (53), Expect = 7.8 Identities = 10/44 (22%), Positives = 21/44 (47%) Frame = +1 Query: 304 PNRDSDAVIDSTKHCSCYGQY**ILSNRDRELTYLSGRNWNSPL 435 P +S + + HC + + +S+ D++ Y ++ N PL Sbjct: 93 PKTESPSFVKYNAHCDDHPEISGHVSSNDKDFAYFEDKSENQPL 136 >SPAPJ695.01c |||S. pombe specific UPF0321 family protein 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 627 YAVPNITRVINDTDAHI 577 Y V N+T + NDTDA++ Sbjct: 61 YLVNNVTEINNDTDAYL 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,752,524 Number of Sequences: 5004 Number of extensions: 55234 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -